Conserved Protein Domain Family
7TM_GPCR_Srv

?
pfam10323: 7TM_GPCR_Srv 
Serpentine type 7TM GPCR chemoreceptor Srv
Chemoreception is mediated in Caenorhabditis elegans by members of the seven-transmembrane G-protein-coupled receptor class (7TM GPCRs) of proteins which are of the serpentine type. Srv is a member of the Srg superfamily of chemoreceptors. Chemoperception is one of the central senses of soil nematodes like C. elegans which are otherwise 'blind' and 'deaf'.
Statistics
?
PSSM-Id: 370977
View PSSM: pfam10323
Aligned: 25 rows
Threshold Bit Score: 197.072
Threshold Setting Gi: 75014001
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q9XVM5    19 LFLFTIVTFILYFIEIQIVFSYRKTT---FKGPFYRLLFVGIIVDIISVINMFMGQVVPAQRWFEPFLIRNQNWLGSVFL 95  Caenorhabditis elegans
O45353    11 FIYEYFILIPIYIFILLGILITRNRHk-tFQSPYYTMMVSQGLADVCTVTIYIVIIGARYFSIGNVFIYNLSPYSSYSFS 89  Caenorhabditis elegans
Q9U316    23 QIILVTVTFPFYIFLLAFIISAQLRNiddLATPFFKLCISSSFIDLTTLLTNYFGAMFPKFGYFFNFYMGLGQIYPHIYL 102 Caenorhabditis elegans
CAP25930  14 QLILVTITVPLYLFLLFFMIKAQIRKvdeLGTPFFKLCITTAIIDLSTLFANYFGAMFPKMGFFADFYRNLDYIYAHIYF 93  Caenorhabditis brig...
Q86DM4    16 QFAIVTVTVPFYLFLWYFMIKAQFRKfdeLATPFFKLCISTAIIDLSTLFANYFGVMFPKFGFFNDFYIYLDAIYAHIYL 95  Caenorhabditis elegans
Q9U312    32 QFSIFCVTISIYLVIVWALIEAQNRRveeLSSPFFKLCLSTAGVDIWTLLTNYLGAMFPKWGWFVSVYLFLGNPYGRIYL 111 Caenorhabditis elegans
Q9XU18    31 QFSIFCFTLPFYIFVIYFLVDAQLHGkqeLCTPFFKLCVTTAIIDICTLLNNYLGAMFPKWGWGTGIYIFLDGYCAHFYL 110 Caenorhabditis elegans
Q9U306    30 QFSIFCFTLPFYVFVTYFLLDALHRGideLSTPFFRLCITTAFLDIWTLLNNYLGAMFPKWGWGTSVYLFLDSYYAHAYL 109 Caenorhabditis elegans
Q23041    22 FMLGSFVTILLYFVEILILVTLRNTV---YKGMFYQIFTIGIIIDVISLVNNYFGCVFPAKGYFRDFYLSMGTFVGQMYL 98  Caenorhabditis elegans
P92000    23 LLLLTIVSFLLYFIEIQIIFAYRKTT---FRGPFYRLMFVGIIVDMLSTINMFTGQVIPARRWFEPFLIYNQSWLGSIFF 99  Caenorhabditis elegans
Q9XVM5    96 VITYGGRCIQGATAAILSFCRVCAVCFPI-FYRKLGEPCYLFIMQAIQ-LGGGVLAWVLLGPDLYEYILEDDglFAVGSE 173 Caenorhabditis elegans
O45353    90 NTGPFMFTLRGVGVFFITTQRYLAVCRSHgTLNYRLNQCPPLLIGFTHwLVAFLIYLPALLHTDIYFENEVT--LLTVGS 167 Caenorhabditis elegans
Q9U316   103 YIAWSMGICQAMSVSVLATNRLSAMIFPE-HYRKIWKSNKLWIGVGIQfLPGLGIGCCTFFNTTEIYINGNGgiIPRFID 181 Caenorhabditis elegans
CAP25930  94 YIAWSTGICQAASVSVLATNRLSAIILPQ-SYKKMWHSSRLWIPISIQyVPGMLVGLLTFFNKTTLATNENNglMPQFSD 172 Caenorhabditis brig...
Q86DM4    96 YIAWSTGICQAMCVSVLATNRLSAMLLPG-SYHKMWKSKRLWIAISVQfLPGMLVGLLTFFNKTQLAINEKNglVPVFLD 174 Caenorhabditis elegans
Q9U312   112 YFAWSTGICQAMSVSVLASNRLSVMLFPT-SFNRIWQEHRLWIAISIQyLIGLIIGLSTFLNDVQLFRNSKNgiVPRFLN 190 Caenorhabditis elegans
Q9XU18   111 YFAWTSVICQAMCVSVLATNRLSAILFPH-RHFQLWNSKRLRIAVLIQfVPGMIAGCATFFNSTQLYRNAKNglVPKFQN 189 Caenorhabditis elegans
Q9U306   110 YFAWASGICQAMCVSLMATNRVSAILFPN-RHSRIWSSTRLRIAIAVQfLPGLLAGLATFFNETQLYRNTKNglIPRFKS 188 Caenorhabditis elegans
Q23041    99 MIAWTARGIQGCTVVALALNRATAVCLPI-KHKQIWNSKYISLIHVFQlGVGLCIGS-SLITQNFYWKFERNgiYIQFYN 176 Caenorhabditis elegans
P92000   100 VITYGGRCIQGATAAILSFCRVCAVCFPI-FYHKLGEPWYLHTMQAVQ-LAGGVIAFVILWPDSYEYILEDNcfYSVGSD 177 Caenorhabditis elegans
Q9XVM5   174 VSESLWFFDFAAVMEVVLVIAIIVNNVITYVMFRmkfkkkvvfnknaitpRQMQSSQEKQKRESGLDKMTFIVCFLELVY 253 Caenorhabditis elegans
O45353   168 TTFVQWTSLTVMTSYFVTCVSIIIMYSQIAVVMVrark--------veqgVLTSTKTTKKLKDARLTLHVFILVLFCIVT 239 Caenorhabditis elegans
Q9U316   182 KQMTSTFFKIGGSFLFLNCLYLIIAYFYLFYSLKkrnsri-----anfpvSKS--KQIQKLREIRLFIMISITVAVQLTI 254 Caenorhabditis elegans
CAP25930 173 KKMTTIFFTIGGGFLFSNCIYLIFSYCYLFVVLRkrntql-----sflstNVPKTKEKARKRERRLFTMCSIIVAVQMTI 247 Caenorhabditis brig...
Q86DM4   175 KQMTTIFFSIGGFFLFANYIYLITAYCFLFIILHkrnakl-----nslsiNVSKTKENDRKRERRLFIMCSVIVSVQMTI 249 Caenorhabditis elegans
Q9U312   191 KSMTNTFFAIGGVFLFVNCVYLVATYCYLFWVIRkrqrinm---pptpviTNS--RSKAKMREARLFTMSTIIVGVQMCI 265 Caenorhabditis elegans
Q9XU18   190 EDHVTYFFLIAGAILTVVCVYLIIAYSYLLAVLRknsnai-----kdsnmQKS--KTQIKKKEMKLFIMSSITVVIQVAA 262 Caenorhabditis elegans
Q9U306   189 ENFIAVLFVIAGGFLATVCIYLIIAYCYLIFMLRkssnai-----kntqfHKS--RAVIKKKEVKLFFMSSITVAIQISI 261 Caenorhabditis elegans
Q23041   177 KDFRRGFFMSAYVIETIFVASIMLINATMVIAFRtkykvr----lttqphLNQKVMNDKQRQEYNLNIVAALTCVAEIIY 252 Caenorhabditis elegans
P92000   178 DTDADWFYNFVAIMEVVLVLAIIVNNVVTYTMFRlkfnkksaiksnsitpSQHQSNQEKQKRENGLDKMTFIVCLVELIY 257 Caenorhabditis elegans
Q9XVM5   254 FAFVVYSLQINQTMNKR-TFYF--YYNILCVIYSTVSAWTLLIFSKPINLQVREKFSK 308 Caenorhabditis elegans
O45353   240 FFFYIGEYVLATDADNDrVRALrlFYPTLSGNLSFINPIMLLMMNRDVQSAFCCRFKV 297 Caenorhabditis elegans
Q9U316   255 LIFFSLKLLKFFELNME-EFYL--FYNALSDLFASINPYLLWIFSDSLRKYVYWKMGI 309 Caenorhabditis elegans
CAP25930 248 LLFFILKVAKLFELTVD-EFYL--FYNLLSDLFASINPYLLWIFSDSLRKYVLTQLRL 302 Caenorhabditis briggsae
Q86DM4   250 LIFFILKVAKVFELTLD-EFYV--LYNLLSDLFASINPYLLWIFSDSLRKYVLYQVGl 304 Caenorhabditis elegans
Q9U312   266 LILFIFKGADILAFTSD-QFYL--VYNAVSDLYASINPYLLWVFSDSLRKYILQRLGF 320 Caenorhabditis elegans
Q9XU18   263 LCLFASYAASILVISLD-KFYL--LYNAMSDLYAGINPYLLWIFSDSLRKYILIQLGL 317 Caenorhabditis elegans
Q9U306   262 LCLVIVYATSLLNFPLD-KFYL--FYNAISDLYAGINPYLLWIFSDSLRKHIWHRIGW 316 Caenorhabditis elegans
Q23041   253 YCYVIYVFGINTSVPTR-VFYL--LYDVINDLYCGISGWLLLIYSRSMKAHVTKMLRC 307 Caenorhabditis elegans
P92000   258 FAFVVYSLQINQYMNKR-IFYF--LYNILCVIYSTFSAWMLLIISKPINSQVRQNLGG 312 Caenorhabditis elegans
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap