Conserved Protein Domain Family
7TM_GPCR_Srj

?
pfam10319: 7TM_GPCR_Srj 
Serpentine type 7TM GPCR chemoreceptor Srj
Chemoreception is mediated in Caenorhabditis elegans by members of the seven-transmembrane G-protein-coupled receptor class (7TM GPCRs) of proteins which are of the serpentine type. Srj is part of the Str superfamily of chemoreceptors. The srj family is designated as the out-group based on its location in preliminary phylogenetic analyses of the entire superfamily. Chemoperception is one of the central senses of soil nematodes like C. elegans which are otherwise 'blind' and 'deaf'.
Statistics
?
PSSM-Id: 370974
View PSSM: pfam10319
Aligned: 35 rows
Threshold Bit Score: 336.907
Threshold Setting Gi: 74966932
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
O16981         1 MLDDIIYYFTPRVFCALTFLVNPFFVYLIFTEKAA-KFGNYRFILLFFATYNLTFSVFNIVFPMDIHTYRYCFYLMIKDG 79  Caenorhabditis ...
P91506         2 IYMNWYHQNVPKILGALSFLVNPIFIYLVVTKTKT-QVGSYKNLLIMFSVFDILYSISEILTPLGVQGNKHGFVVFISDG 80  Caenorhabditis ...
Q9UAW7         2 IYISWYHQNLPRIFGIFSFIINPIFIYLAMTKSRS-QMGKYKYLLIIFAIFDILYSISEILTPIGITGNKHGFVVFLTEG 80  Caenorhabditis ...
P91507         2 IYISWYHQNFPRIFGVFSYIINPIFIYLALTKSKT-QMGNYRFLLVAFAVFDLFYSTNEFLTPLAVTGNSHGFVVFLTEG 80  Caenorhabditis ...
P90760         2 IYIGFTHFWTPIIFGTLSYFSNSIFIYVVLLNTRA-NIGAYKYMLVCFGLFDITYSTVDMLVAMGSHSEGNTFCVFVTHG 80  Caenorhabditis ...
XP_002636682   2 IYVGFLHHWAPIIFGILSYICNSIFVYIVLKKTRS-SFGAYKYMLMSFGIFDIMYSTVDMVVAMGSHSEGNTFCLFVSHG 80  Caenorhabditis ...
O01456         1 MNIRWAHRYIPAAFGYLSFVLNPILGYLILTEPKSaTIGKYRYLILFFAVFDMVYSTVELLVPLGMHGTGSAFVTYLAHG 80  Caenorhabditis ...
Q966G6         1 MLIRWAHRYLPAVAGYLSYVVNPVLAYFILTEPKNsSIGKYRFLILFFAVFDMVYSTVELFVPVGMHGTGSAFVIYLAHG 80  Caenorhabditis ...
P91504         1 MYIHWSHHYLPKLFGILSFVCNPIFICLIATEKKA-SIGKYRYLLIGFAIFDMAYSTVELIVPVAIHGTGAAFVIYLADG 79  Caenorhabditis ...
O17809         1 MYIHWTHYYLPKVFGVLSFILNPFFIWLILNENIT-ALGSYRYLLVTFASFDIIYTLVELAVPMSIFGTGAAFAVFVSGG 79  Caenorhabditis ...
O16981        80 WFVESTE--LNFHLLVARCSIVFASNAILLTHFVYRYLVIHESNFTKKYF-GWYIAASFLIFGLFFGVWYAICYHLARVN 156 Caenorhabditis ...
P91506        81 LFFEYPE--LGQHAMSNRCGFISISYALLIIHFVYRYMALFYPHKLHLFFrPIGILFLTLLMLFHAGSWTMICQNCLAAD 158 Caenorhabditis ...
Q9UAW7        81 PFFEHPE--IGQHVMSNRCGFISLSYALLIIHFVYRYMALFHADKLPIFFqPLGIIISIIFLLMHAASWSVICQQCLAGN 158 Caenorhabditis ...
P91507        81 PFFEHPE--LGAHAISNRCGFISLSYALLIIHFVYRYIALFHPELHRNFFhPIGVLIYALFLLIHGASWSVICQQCLGGT 158 Caenorhabditis ...
P90760        81 PFSNYLD--LGFFAPCVRCMFFSLSYGVLELHFIYRYVALCYPKRLSHFGdPKWILIMISAVFGQGLLWFFSVYFLMWPD 158 Caenorhabditis ...
XP_002636682  81 PFAEDPE--MGFAALCVRCMFFSLSYGVLEVHFIYRYVALCRPQWIPAFAdPKWITAMALGVMGQGIVWFCSVYFCMWSD 158 Caenorhabditis ...
O01456        81 PFFGKDTirLAQFAISVRCGFIALSYGILIIHFIYRYIALFRPQLIDDVFrPMGICCMMTFFLAHGVAWTAVCELCLYAN 160 Caenorhabditis ...
Q966G6        81 PFFGKEHmrLAQLAISIRCGCISLSYGILVIHFIYRYIALFFPQFVKKVFqPLGMCCILIFFLIHGIVWGGICELFLYAD 160 Caenorhabditis ...
P91504        80 PFFGTGK--LGQLAVSIRCGCISLSYGILVIHFIYRYLVLFNTRIIDRLLrPSGLFGLFVFFVFHGIAWSSVCEMCLYGD 157 Caenorhabditis ...
O17809        80 PFYGTGK--LGQFALSVRCGFISLSYGILVIHFVYRYSV--FTQISHQKLgFWALLGLFIFLISHGIVWSSVCELLLYGD 155 Caenorhabditis ...
O16981       157 IEIRQYIREDFRETYGTDSKNYNMIGVLFQEGSEETTFRSWIVIILWTSLSVASLISFIILATLIMCKLk--KTAMHVSQ 234 Caenorhabditis ...
P91506       159 DEVRKIVRSSFIDQYGEESNGVPMLAALYWGVRPGIQFRSWLGIILLTIISWYSMAVYFVLGYKIIHKIrcmTINRTLSA 238 Caenorhabditis ...
Q9UAW7       159 EEVREIISIDFLENFGANSKSLPMLAAIYYDASDYIRFRSWLGIFLLTAFSFYAMSVYIILGFKIMRKItlmQSTNKLSK 238 Caenorhabditis ...
P91507       159 DEIRELIRDEFMAEYHADTRDVPMLAALYWNASDAIRFRSWLGIVLLTVISFYAMTIYFVLGYKIMRKIrsmQANSSMSK 238 Caenorhabditis ...
P90760       159 SETRSYLVIPFRRDYNADVHKIPLLASTYWGASTQLILRTSTAIIIVTLISCFTICFCIWIGWTIQSKL----KVADMSK 234 Caenorhabditis ...
XP_002636682 159 DEMRSYLEVPFRRDYNADVYKVPILGSTYWGASTGLIARTSAGIVIISIISCWTIYFCIWIGWTIHSKL----SVVEMSK 234 Caenorhabditis ...
O01456       161 DEIRDYIRTTFRDEYDVDSYDIAFVAALYIDGSNETKNKSWAGIFLLFSISSFAVSFYLILGRKIVVKL---RTHTALSQ 237 Caenorhabditis ...
Q966G6       161 DEMRDYIRDVFRETYEVDSYDIAFLAALYLDGSKEVKTRGWVGIGLLSCISVYAVSLYIILGRKIVAKL----NTQNISQ 236 Caenorhabditis ...
P91504       158 QEVFDYIYDAFQKDYHVDSHDLSMLMALFFDASPEIKRRSWIGILLLTGISIYAISLYVILGWKIMKKL---ADNPGVSA 234 Caenorhabditis ...
O17809       156 QKVADYIYKQFMKDYHVDSHGLFFLMGLFYDGSSEIVRRSWGGILILTGVSFYAAPLYFILAWKIVRKLa--NDNPGVSV 233 Caenorhabditis ...
O16981       235 ATSKFQFELLRALIVQTIVPICISYSPCLLCWYSPMFGVQLPREVNYFEVSALGIFSFVDPLAIIFCLPPLRKRI 309 Caenorhabditis elegans
P91506       239 TSLRLQRQLFVTLVVQTCIPIVASFLPTVISWYAPIFGIDIGWWNTNVSTIALAAFPCIDPLAVIILVPNYRNTL 313 Caenorhabditis elegans
Q9UAW7       239 NSIRLQKQLFQTLIIQTCIPIIGSFLPTVISWYAPIFGVNMEWWNMNVATVAMAAFPFIDPLAVIYLIPSYRNAI 313 Caenorhabditis elegans
P91507       239 NSIRLQKKLFLTLIIQTCIPIFASFLPTVLSWYAPIFGIDLSWWNTNVATVALSAFPFIDPLAVIYLVPSYRNAI 313 Caenorhabditis elegans
P90760       235 TTKRMHRNLLKALAIQTFIPFAISYIPCVVAWSVPIIHVDTKSLNNYTSIIAVAAFPFIDPLAIMVFLPEYRKLF 309 Caenorhabditis elegans
XP_002636682 235 TTKKMHRNLLKALAIQTFIPFAISYIPCVFAWTVPLIHVDSKSLNNYTAVIAVAAFPFIDPLAIILLLPDYRNAF 309 Caenorhabditis briggsae
O01456       238 QTRNMHRQLFLVLAFQTIIPVCICFSPCMMAWIGPMFYLDFGMWDNYFGVIAFSAFPFLDPLAIICLLPNYRTRI 312 Caenorhabditis elegans
Q966G6       237 ITRNMHKQLFMVLAVQTIIPVCISFSPCMMAWYGPMFYLDLGMWNNYFGVIAFSAFPFLDPLAIMFLLPNYRKRI 311 Caenorhabditis elegans
P91504       235 TTQKLHRQLFKALAVQTFIPICISFSPCMMAWYGPVIGLDLGMWNNYLGVIALSAFPVLDPLAIIFLLPNYRNKL 309 Caenorhabditis elegans
O17809       234 ITQKLNRHLFKALVVQTLIPICICFFPCMVAWYGPAFGVNFGNWSRYLGAVAFSAFPDLDPLAIILLLPYYRNKL 308 Caenorhabditis elegans
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap