Conserved Protein Domain Family
7TM_GPCR_Srh

?
pfam10318: 7TM_GPCR_Srh 
Serpentine type 7TM GPCR chemoreceptor Srh
Chemoreception is mediated in Caenorhabditis elegans by members of the seven-transmembrane G-protein-coupled receptor class (7TM GPCRs) of proteins which are of the serpentine type. Srh is part of the Str superfamily of chemoreceptors. Chemoperception is one of the central senses of soil nematodes like C. elegans which are otherwise 'blind' and 'deaf'.
Statistics
?
PSSM-Id: 402095
View PSSM: pfam10318
Aligned: 174 rows
Threshold Bit Score: 150.386
Threshold Setting Gi: 74966501
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
XP_002647455   9 EQPFGFTIIHFVCTGLSIPSYILAFSILIFKSPAHFKKYRNYLVAHIFSGLLLEIHMGHIWKVTVVLPIPIMCSNSFTAE 88  Caenorhabditis ...
CAP26233      31 ELNGYYKTLCHFTPFFTIPIYAEAFYCIVYKCKQFSPKYVQLLTVHTFLHLFAEVYWTVLLLPCVNLPTIGVSAEGFLSV 110 Caenorhabditis ...
P91841        20 KLNSHYKLSCHIIPFVTLPVYAEAFYCVFYKCKHFSKKYVVLLQIHLFLHFFGELYWTILLIPVIVIPSIGVSADGFLSV 99  Caenorhabditis ...
Q9TXK5         9 EQPSGFSTLHIISTSISVPIYIVAFWILIFKSPVHFSKYRNYLVAHVFSGLLLELHMGTIWKVTIILPIPIMCSNSPLAE 88  Caenorhabditis ...
Q9N5I5         9 EEPLDFMIIHYIALALSLIVYGISFYVLFFETPKHFSKYRNYLISHIFSGFLLDIVMGVLWKVTIVLPVPIMCSNTFISE 88  Caenorhabditis ...
Q9TXK6         9 EEPFDFMIIHYIALTLSIIVYAIGFFVLIFKTPKHFSKYRNLLMAHIFSGFLLDIVMGVLWKVTIVLPVPVMCSNTFASE 88  Caenorhabditis ...
Q9N5I6         9 EEPFGYTVVHYICTPLSFPMYSLAFFILLFKTPSYFNNYRNFLVSHIFSGLLLEVHMGMLWKVTVVLPIPIMCSNSFAAE 88  Caenorhabditis ...
P91981        19 PAPDPYKSMMHFTHVLTIPLYLTAIYALINNCPKTLKEYRKYLLWHTLGNLLFELYISLFMLPVTYLPYPVFRGAGFLKY 98  Caenorhabditis ...
Q23029         9 PAPAFYTSMMHNFHIISFPLYIVTLNALFRESSQIFSTYKYFIIVHIIINIISECYVSFMMLPMTYLPHPMFRNTGWLAD 88  Caenorhabditis ...
NP_001024135   8 PTSPFLKYLGHIFVCLTAPIYIATCFILIWKCPSFFNQYRTLLLRHIFTCIFMEYFMDAIWQLIVVVPWSALCSMGIGYQ 87  Caenorhabditis ...
XP_002647455  89 Y---APIVFQFLPSCLVYTGVSIVLLFVYRMEVMVVHRAeqfYYRRKLahFSKFGFYISVIIlLVLSVLIYS-DL----- 159 Caenorhabditis ...
CAP26233     111 LkvsASWQIFFMCGLLQIGTATMIHLLIYRLKFAVPSHAansQCVKFS--AVAANLFYYCTAiLCTCALGFM-------- 180 Caenorhabditis ...
P91841       100 LkisPSWQIIIMCGILQISTATMIHLLIFRLKFAIPPNAkyrSVIKYS--VDFLNIFCYCTTiFCTCALGLL-------- 169 Caenorhabditis ...
Q9TXK5        89 Y---APILFQLLFVCFVYTGISAQQLFLYRMEAVVIFQNensRLKKLVt-ITKFGFYIGALLiTLFAILIYP-DL----- 158 Caenorhabditis ...
Q9N5I5        89 Y---ATIVFQLLPVCFAYTGASAISLFVFRMEAVIVHRTeqtFLRKVVk-YIQYAFYVSIVLvVIGTVLIYP-DL----- 158 Caenorhabditis ...
Q9TXK6        89 Y---APNVFQLLPACFAYTGASAISLFVHRMEAVIVHRSeqsTLRKVTk-YLKYAFYMSIVFvLILTILIYP-DL----- 158 Caenorhabditis ...
Q9N5I6        89 Y---APIIFLFLPVCLIYTGTSIIALFVYRMKAVTIYEAeksILKQCTm-LLKYAFFISLIVvLIFTFLIYP-DL----- 158 Caenorhabditis ...
P91981        99 LdisGLIQFYLLVICLIHTGLSILEMFKYRFNSTISDDT--------LnkKVLNYIVMFFWV-IVIIIPVFCfATlprch 169 Caenorhabditis ...
Q23029        89 LgfsGMFIFYGLAQSVMLTVGSILEMFFFRYNLISVYKNdlfKKLLRF--QVLLYRFLIIIH-PIVAITTINySI----- 160 Caenorhabditis ...
NP_001024135  88 L---PVLMFSIVVAGLCATGISIIHMFEYRMNAVTDDSIk--VLRRVItgVKYYHYFMMTSC-MCLLAASYN-HL----- 155 Caenorhabditis ...
XP_002647455 160 K-YQNDYKLKMEQRFGAFQpYMWC-DNCFFFNF-DSIrfkSF--YVFGAITASLGSFAAGLAFHVTIRTLKSVR----S- 229 Caenorhabditis ...
CAP26233     181 DeDQLVAKNRILKKYLVPHpNLWD-VRFVSTDKeNPTflyYL--YITVGEITILIINIIAVPTISFHYLSANRT------ 251 Caenorhabditis ...
P91841       170 DeDQLTAKNRVYEKFPIPNpNLWD-ENYVTTDIeSYKfktYV--IISVLEIFILCVHIIVIPIVGFHFLSKNQT------ 240 Caenorhabditis ...
Q9TXK5       159 K-YQKSYKMKMEQRFGTFSgYMWC-DNCFFMNF-DSNifkIF--YLICGIGTVMCFSSSFSAFTATIRYLNSVK----I- 228 Caenorhabditis ...
Q9N5I5       159 K-YQKDYKLKMEKRFGTFKpYMWC-DNCFFCNF-DSLtfrWF--FYVAVVAVVLGGFTGGFAFHVTVQALKSVS----S- 228 Caenorhabditis ...
Q9TXK6       159 K-NQRDYKIQMEKRFGTFKpYMWC-DNCFFMNF-SSKifyVF--FIVAGIAVVLGGTTGGIAFHVTVEALKSVS----L- 228 Caenorhabditis ...
Q9N5I6       159 K-YQKEYKLKMEQRFGQFEtYMWC-DNCFFFNF-DSNlfrWF--FDIAAVSVVLGASCAACALLLTIKCINSVK----T- 228 Caenorhabditis ...
P91981       170 P-KQDHYKQDLYDKNPGISiHVLCnTVVTAPPLiDPV---FTplMTLIMMAMLLAATIIPQTFLTIWKKLDQLS----K- 240 Caenorhabditis ...
Q23029       161 G-VEAKATMELWLSNPNLPpEVTC-YSCIIAVLdD---------YVMYIITVIYGIQVILQLTVSSCVLFYILNfvktCq 229 Caenorhabditis ...
NP_001024135 156 A-DQKAFKTKIENKYGELPsYIWC-DNCMFINT-DST---LVl-IFVGVAASSQPLAAVYFGLSVYASKLGLQKl--kA- 225 Caenorhabditis ...
XP_002647455 230 SLSPTTAAIQKNFIISLVVMAIIHGICILLPLLGLLWAISIVitLSKfPYFPYLLVLVIQEHGALSTITMFLTNDLLRKI 309 Caenorhabditis ...
CAP26233     252 EKSDRLARAHRQTLQVLVFQLAIHCLFHLLPLICFTISAIFR--IKN-VFVLSVGAYIWALHGAACTLALILANKPFRIT 328 Caenorhabditis ...
P91841       241 EKSEKLAEAHRKTMQMLVFQLTVHCIFHLVPFVCFTWATIFK--QGN-IGLLSGGMFTWALHGAACTLTLLLANKPFRMT 317 Caenorhabditis ...
Q9TXK5       229 KLSVKTAALHRNFLHSLILTITVHIICILCPVLIFLGAISVVveLSQfPYIPYILLMIIQEHGAASTVTMFLTNNLLRQT 308 Caenorhabditis ...
Q9N5I5       229 NLTAKTRATHRNYLWSISLAAAVHVICIVLPLLGILQTINFIisLSEfRFFPFILTLVIQEHGAISTVIMFMTNNLLRGA 308 Caenorhabditis ...
Q9TXK6       229 RLTAKTKATHRNYLMSLSLAAGVHVVCIVLPLLGVLSAINVMisLSNfRYFPFILTLIIQEHGAASTVIMFMTNNLLRGA 308 Caenorhabditis ...
Q9N5I6       229 QLSAKTKQMHRNFLVSLVISAAIHGGCILTPLLGFLWAISFVisLSQfPYFPYMMVLIIQEHGAISTITMFLTNNLLRKT 308 Caenorhabditis ...
P91981       241 HLSKKTIQLQKMLLTSLFIQAVIHGVMLGAPLIGFIYAVVFVlpY---NYIAYMLLLLISFHGSFSTIAMIAFTKPIREG 317 Caenorhabditis ...
Q23029       230 GMSTATIKLQKMMILSLFIQGGIHGLLIMLPTIFLIYALFFK--SEM-NDLAISLLMCVAYHGFVSTCAMILFTKPLREK 306 Caenorhabditis ...
NP_001024135 226 SLSQRTISLQRNFLHSLYIQTAVHVIFISIPLGIFFLSFIIWipSSA-MYMSYILTAMCTQHGSLSTLALMISNKP---- 300 Caenorhabditis ...
XP_002647455 310 LFRMFSK 316 Caenorhabditis briggsae
CAP26233     329 VKEHLKY 335 Caenorhabditis briggsae
P91841       318 TLSHLKY 324 Caenorhabditis elegans
Q9TXK5       309 IRKMLPV 315 Caenorhabditis elegans
Q9N5I5       309 LKKMFWC 315 Caenorhabditis elegans
Q9TXK6       309 VKKLFKC 315 Caenorhabditis elegans
Q9N5I6       309 LKKLLMF 315 Caenorhabditis elegans
P91981       318 VKSLFQS 324 Caenorhabditis elegans
Q23029       307 ILPFKIR 313 Caenorhabditis elegans
NP_001024135 301 LYSVFTK 307 Caenorhabditis elegans
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap