Conserved Protein Domain Family
7TM_GPCR_Srd

?
pfam10317: 7TM_GPCR_Srd 
Serpentine type 7TM GPCR chemoreceptor Srd
Chemoreception is mediated in Caenorhabditis elegans by members of the seven-transmembrane G-protein-coupled receptor class (7TM GPCRs) of proteins which are of the serpentine type. Srd is part of the larger Str superfamily of chemoreceptors. Chemoperception is one of the central senses of soil nematodes like C. elegans which are otherwise 'blind' and 'deaf'.
Statistics
?
PSSM-Id: 402094
View PSSM: pfam10317
Aligned: 55 rows
Threshold Bit Score: 211.64
Threshold Setting Gi: 187035706
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
O17240    19 FKIIGYIVNPLGILFNTLLIILISTKTPKLLQSYSMLHLNFALCDLFSCLAGMLALQKIV--FSGWSLTYIFHGACGQIS 96  Caenorhabditis elegans
O01608    10 YISYAAVVSTLGIIFNGFLLFLIFFKSPSCLTPYTVFLANTSITQLGYCICFLLTVPRVI--SINLRIVNIYLGFSQFLG 87  Caenorhabditis elegans
Q22594     5 FVIFHSVLSAIGCVLNSMLCHVAAWKSPTVIKTYSIITVNFAITNLTICGVNFILQMRMV--PIEKTMIFVSYGPCQWLT 82  Caenorhabditis elegans
Q17760     8 FIGINSILTLLGCFINLFLCYLAIFQSPKAIRTYSLVLINITLTNVGACVTGFLLDQRII--QSGKSMLYVSYGYCSLLG 85  Caenorhabditis elegans
Q9XWA0     6 YQIIHAILSIFGVGINIFLLFLALTKSPKIMRPCSALITNKSLTDIMSSVANFFVMQRIL--TDGSSVTIIPTGPCTMIG 83  Caenorhabditis elegans
CAP25587   3 YQVIHTIFSSLGVVFNAFMMFLALTKSPPIMRLCSVVITIKTTTDIMTSLINAFVMMRIV--TDGIHVFLIPSGPCTYFG 80  Caenorhabditis brig...
P92001     5 FEIWHWSWALLGCYLNLLLAYLAIFKSPKAIKSYATLIINYAATDFVECALDSFLQTRLLavPGEAELVYIFNGPCKYIG 84  Caenorhabditis elegans
Q9U2P4     5 FEIWHCIWALLGCSFNLMLIYMAIYKSPKTIRSYATLIINFAVTDFFECALDLFIQIRLMpaPGDVTVIYILNGSCKYIS 84  Caenorhabditis elegans
O01468    11 VKSWHIFFGITGVILNLVLILLVVFKSPNAIRVYSRLITNFAVTDFLACLLDIFIEIRVLpsPNEATITYILNGFCTYFG 90  Caenorhabditis elegans
O01466    11 FRILHAIFGGTGCILNAVLILLVIFETPKHIRLYSILILNFAIFDLAACILDIFIEIRVLpyPNEDSMAHIMNGVCKHFG 90  Caenorhabditis elegans
O17240    97 SYFCYFLHVFVCHCLAHSQWILMISFLYRYYILDQISPDTVKIVRICILTYLPSLLFv-----IVYWSDVANEDALKRIV 171 Caenorhabditis elegans
O01608    88 HWWSYMIFTTMLHFAVNSFLSIMLSMVFRCISLKTLRFPTSGAFAMCILAYMIPLSMvvsirgIEITSNFTINSKYTLWQ 167 Caenorhabditis elegans
Q22594    83 DRTCFNLYSVLVHVYTHTIWLLLISFCYRYYVMIRSEPSKRQVELLLLIIYLPSFIQm-----ILLFFDFTDPLILLDIQ 157 Caenorhabditis elegans
Q17760    86 EGFCFNIFAAYLHFHTHALWLLFLSFVYRYYVIIRQEPTKKVLQISVVIVYIPSLIQl-----ISMCLQEMNFDELRSLS 160 Caenorhabditis elegans
Q9XWA0    84 PTACYAGHMFMGSFLEHNLIWLIACYLFRYYILYVCDPSIKSIIFAAFLVYTPSFVHm----aMWIKLFDAEQMEIKMNE 159 Caenorhabditis elegans
CAP25587  81 PVACYAGHMFMTCFLEHNLIWMICSYIFRYYILYVRDPKARTLFLTAFCLSIPSFFHmt--twISFFNLKTNTIAPEELG 158 Caenorhabditis brig...
P92001    85 SISCKVGLSFFLHCLTHSVWSLLLSFGYRFYILHNPSLSRLVLLKLILVFYIPSLIQa-----LTYWTIFASREEILPLA 159 Caenorhabditis elegans
Q9U2P4    85 QFACKIGLSLFLPCITHSVWSLLLSFGYRYYILHYSALTRLKLVKIVLLILIPSLFQg-----LTFWTSFAPLEIILPLA 159 Caenorhabditis elegans
O01468    91 LSTCAIGLSMYIHTLTHSLWSLFISFVFRYLILYKVSLKEKHILLALFVFYIPSFVQa-----ATYWTSFVDSSTILPIT 165 Caenorhabditis elegans
O01466    91 LTACAVGFSLYLHTLTHSIWSLLISFAYRYLILFKTTFKRNNILLVILAFYFPSFLQa-----VTYWTNFVERFEILPIL 165 Caenorhabditis elegans
O17240   172 NSFHPEYIYDSK-EiwgdlvIAGNMSCWSAATFSAIVYMTIPCFPIYGVIVFFRHKTLKSLDGrGRITMSETTRSSHKQL 250 Caenorhabditis elegans
O01608   168 LENLDKYRT-----------VVG-TTMAQLSTLWVACCVSILCIPIYSVMFWCRYRILRMLER-PGYMFNTTTTLQIKRL 234 Caenorhabditis elegans
Q22594   158 QNLVPQYNFTDL-M------IFGVADSTSFNAMYSIVHVAVMSTPIVLCIVVLRKKILRKMEF-KGVQVNANTRSLQLQL 229 Caenorhabditis elegans
Q17760   161 KEVVPQYNLTGL-T------ITGSLDFFTFAPFYCLVHMAIISFLIAIGIHILRKMIINRMVL-NGVDVTIRSRNLHAQL 232 Caenorhabditis elegans
Q9XWA0   160 TELFANELEFPEmQ------LTG--RIVYWSSIVVYVQLVFTALLVVIAYTWIRNVLINFLIS-MGVSLSKDVKIINRQL 230 Caenorhabditis elegans
CAP25587 159 LDEAPNI------I------LTG--SLIYYSTITVFVQLAITAFLVLLTYIWLRDVLLNYSLR--MGAVTSDTKKLNRVL 222 Caenorhabditis brig...
P92001   160 RQWFPYYDLDAE-Tg----vLTGIIDLTNFVAIYSIGHICLPFFPVYITIFILRQKIINQLHV-KQHVMSPDTKAAHSQL 233 Caenorhabditis elegans
Q9U2P4   160 KKWFPQYNFEAE-Tg----vLTGIVDITHWAATYAVFNICLPIFPIYIAIFILRQKIITFLGA-KTQSMSPDTKAAHSQL 233 Caenorhabditis elegans
O01468   166 KRIYPQYNFELE-Tg----lITGITNLFSVSAIYAVLHMTIPVTPVYITIFILRRKILKTLMM-SYNVMSKETKAIHAQL 239 Caenorhabditis elegans
O01466   166 MRVHPDYDFSDS-Si----lITGITNLYTPSVVYGMLHTTLPVTPIYIAIFITRWKIIKVLKK-NQSSMSKGTRAQHDQL 239 Caenorhabditis elegans
O17240   251 IKALTIQAIVPIFWLT-ASTFYLLALFQVVGRVIVENMPFRIMECMPMITPLISLYFVRPYRSALTG 316 Caenorhabditis elegans
O01608   235 VKALTVQSLIPVFTLFpASLIFLSTQFHVIETTKFGYIIISLLSLSPTIDPLVTIYYVQPYRKYIVD 301 Caenorhabditis elegans
Q22594   230 LRALTFQAVIPGFYLI-GVASYFVSRLEIYRDPFFEYLIFSAFLFVPVLTPISSFIFVTPYRKWFLK 295 Caenorhabditis elegans
Q17760   233 LRTLSFKATVPIIYYF-GCIFFILGR--IWINPIFEFSIFVPTVIVPVLTPLSAFIHVAPYRDFVSK 296 Caenorhabditis elegans
Q9XWA0   231 VKILTFQVCIPIWIFL-GVFFFLAMYTQSTRPDTLQYAITISFMLAPVVSPFAYIFFVPHYWNFCIG 296 Caenorhabditis elegans
CAP25587 223 VKIITFQVFLPIFIFT-GVTIFALQYSGWVQQEYLDYMISLVFMCSPILSPFSYMLFVPHYRNFFAI 288 Caenorhabditis briggsae
P92001   234 LKALTIQAFIPIFVGI-AVTFYFLSQSGLVRSPILEYSIYAVAILAPALSPITYLYFVRPYRQNVKR 299 Caenorhabditis elegans
Q9U2P4   234 LKALTIQAFIPIFMGI-GVIFYLIAQSGLIVSPIVENAIFSIAILMPALSPLTYFYFVRPYRQFLKR 299 Caenorhabditis elegans
O01468   240 MKALTFQAFIPVAAWA-AVYVYIGMQFGIISGIFFEYMVFSTVIFMPLLSPVAYLVYVRPYRLYILR 305 Caenorhabditis elegans
O01466   240 LKILTIQAILPSTSFF-TSWLFMGLRFGLFQGQVYEHLVFSCAIFMPVISPIIYIVFIKPYREFFVR 305 Caenorhabditis elegans
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap