Conserved Protein Domain Family
7TM_GPCR_Srbc

?
pfam10316: 7TM_GPCR_Srbc 
Serpentine type 7TM GPCR chemoreceptor Srbc
Chemoreception is mediated in Caenorhabditis elegans by members of the seven-transmembrane G-protein-coupled receptor class (7TM GPCRs) of proteins which are of the serpentine type. Srbc is a solo family amongst the superfamilies of chemoreceptors. Chemoperception is one of the central senses of soil nematodes like C. elegans which are otherwise 'blind' and 'deaf'.
Statistics
?
PSSM-Id: 402093
View PSSM: pfam10316
Aligned: 59 rows
Threshold Bit Score: 198.526
Threshold Setting Gi: 74966723
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q5F4V3      1 MKTAV-LLVCFTGMVCASIEVLLNTNLVWKIV-------------LRKS-QRKCEMGLFYYRFALDLCFGLALLSYISFI 65  Caenorhabditis ele...
O44692      1 MLSVS-VVISSIGVTSSIVSCVVNTYMFVTVE------------------RRKNDMTLFYFRFLLDVILSVLVAAFLTSD 61  Caenorhabditis ele...
O16943      1 MLHIT-VIISLIGIASSMVSCSVNTYMLVTVE------------------RRKKDMVLFYFRFLLDGIISILIAAFLSCG 61  Caenorhabditis ele...
Q9N4Q8      7 MNVSA-LIVTAIGVFSSLFAFAMNIYILKNFE------------------RKKNDMALFRFRFFLDVVLGSTTAVYLASM 67  Caenorhabditis ele...
O44694      7 LKTSA-VVITCFGVFFSIFNCVGNVAIIKKMG------------------RRKNDMVLFYFRFLLDVIFGATSTIYLLSI 67  Caenorhabditis ele...
O44695      7 LDISA-EITTFFGIFFAIFSSLMNIFNLKKIE-------------K----KKKNDMVLFYSRFIFDAFYGITVTIFLSLM 68  Caenorhabditis ele...
O44696      2 FSYLE-IIINLIGVFFAIFSCFINIFNLKKLE------------------KKKEDMVLFYFRFFLDAFFGATILFFFASS 62  Caenorhabditis ele...
O44697      2 FSYHA-IVINFIGVFFAIFSCFINIFNLKKLE------------------KKKEDMVLFYFRFILDAFFGATILFFFAIT 62  Caenorhabditis ele...
Q5F4U4      1 MNITTpIIVSFIGLFPSVFTCVVNLFSLKKID------------------RKKNDLVLFKIRFFLDVVLGASVVAHLGFV 62  Caenorhabditis ele...
NP_503593   1 MNVTTpVIISMIGLLPSIFTCVLNISLLKQIErlfkfsalklfstFKSIfRKKKHLILFKFRFFFDVILGASVVAHLGFY 80  Caenorhabditis ele...
Q5F4V3     66 LIFSEKSEFMi-eHRNLLTYLGLFWSNTASCRSILALAIAAERATAVCLPILYRTVNLKIPNLLILLVAIAYGLFEDVVL 144 Caenorhabditis ele...
O44692     62 IIYFTFSEKMdsqLIVVIFYIPLLASNVAAVRSIVILFISVERVVASYFPIFFHNHRKFRFKVFIMILAVFYGLTEDIVL 141 Caenorhabditis ele...
O16943     62 ISYSMFPEQFs-qTQNLIFYLSLPASNFSAIRSIVALFISVERVVAAYFPIQYHNYHQSFPKIPIMITAIIYGFNEDIVL 140 Caenorhabditis ele...
Q9N4Q8     68 GISAVYIKESt-eFANFVFHIGFFTSNIGVSRSLITLAISIERFVAVYFPILFLQKHPFFPNSVIPIIAIGYGVFEYPVL 146 Caenorhabditis ele...
O44694     68 IIFNLNYLKLs-dLRVFIFFLGFLISNVRATRALLTMAISIDRVVAVYTPIWFLNYRSLVANSAVLGLTAAFGLSEYPVL 146 Caenorhabditis ele...
O44695     69 IAANFNNLET---INHFTLLSGLLVWNVGISQAVVALMISIERNMAIFTPIFYRNHRSLVTNSVILCLIFGYAIFQYSFI 145 Caenorhabditis ele...
O44696     63 IASNFSAEEI---VIKLIYLSGLLGTLVGRARAAVTLMITVERILAVFTPIFYRNYRPLISNLAILSLIVGYGLFDYLIM 139 Caenorhabditis ele...
O44697     63 ISSNFSGEKI---FNSIIFLSGFFSSLVGRARVAVTLMISVERVMAVFTPVFYRHYRPLISNSAILSLIIGYGLFDYLIM 139 Caenorhabditis ele...
Q5F4U4     63 LILATFHEELi-pWKNVILYLSLFSWNIGSARSVTVLAISVERVVAVFAPISYHNYRPYFPTFLIPIAAISFGASDIFIL 141 Caenorhabditis ele...
NP_503593  81 IILTSFHDEFl-pWRNMIFYFSLVSWNIGAARSLTALTISVERVMAVYVPITYRNYRPYFPTFVIPIFAIGFGASDIFVL 159 Caenorhabditis ele...
Q5F4V3    145 FKFCEFNVnSIPDTCKQFGCAINKCFFSYFMLHRCIVFSINICVSIVLSVKLL--FWNRkqshqHKNNNNNKLSKANRLA 222 Caenorhabditis ele...
O44692    142 YVFCDFQL-KLVPNCVAFGCTINACYHQYWITHRMTVFALMFLFSIFLASKLF--MLRK-----SKNVGKNEQFRMNRLA 213 Caenorhabditis ele...
O16943    141 YVFCDFQL-NIPKNCTALGCAINECFYQYWTTHKSIVFALIFLSSLALCFQLF--MLNK-----REKKGKNELTKLNRLA 212 Caenorhabditis ele...
Q9N4Q8    147 YSFCNFEL-NIPYGCVTLSCSLNLCFYQYWTTYKTIVYILTFLSTIVLTCKLLlkIHES---------QSNNLTRANRLA 216 Caenorhabditis ele...
O44694    147 YIFCEFEV-DIPPKCVSINCALNDCFLQYWTTYKMIIFACTFIFTILLSLKLIskIFKD---------DNKDLNRANRLT 216 Caenorhabditis ele...
O44695    146 YYFCNFEL-TFPRNCLTIGCSINACSSRFWTKSKLVIFVLTFSFAALLSSKLLwkVFKK---------DNKDFNKANLLA 215 Caenorhabditis ele...
O44696    140 RFLCDFKF-VIPTNCITAGCSMNLCSSQYWATSKTVIIAFTFLFAIMLSLKLLwkVIKE---------KNKDFNNANRLA 209 Caenorhabditis ele...
O44697    140 YFFCDFEF-VIPTSCVTLTCSMNLCSSQYWATSKSVIIWLTFFFAIILSMKLLwkVIKE---------KNKDLNKANRLA 209 Caenorhabditis ele...
Q5F4U4    142 FGICEYEI-DVPEGCAALGCCINACFTKYYSINKGITYISTFTFTLLLSTKLL--YLKN------YNAEKKSLSRANILT 212 Caenorhabditis ele...
NP_503593 160 FNICDYQV-NVPKECAALGCCINACFNKYYSINKGTAYILTVMFAILLSTKLF--FLNK------DSTEQKTLSKANLLA 230 Caenorhabditis ele...
Q5F4V3    223 LLDTCTVFLFDFIPVLCGNMWp--QYFSGENLGPFTVVMKVTGCAIESIVVSCLLKFGK 279 Caenorhabditis elegans
O44692    214 LIDIGNVTLFEFFPIFLANQLs--KYFNFKSLGPYGISIKMLGCAVEAVLMLYILKGKK 270 Caenorhabditis elegans
O16943    213 LIDGVRVLLADFLPNLVANQLsrgGFSIFQSLGPYEVVAKKFGCATEAILVLYTLRHRT 271 Caenorhabditis elegans
Q9N4Q8    217 LIDCIVIFLFDFFPILFEKLVtqkNIFTPRNLGSYSTVTKLSGCAVEAFLVYRTVIRKQ 275 Caenorhabditis elegans
O44694    217 LIDSTIIFATDFLPTMLC-LMgheDLFNTQNMGPFGAVLKQVGCAFEALLVLQTITRRN 274 Caenorhabditis elegans
O44695    216 LIDAAIIFLFDFLSIVFFNFTdrvETFSIHNIGPFATSLKQVGCTIEALLVYRTITKKN 274 Caenorhabditis elegans
O44696    210 LIDAAIIFLFDISSSIISYYV-----IKINNGGPITAALKQFGCVIEALLVFRTITRKT 263 Caenorhabditis elegans
O44697    210 LIDTAIIFLFDILSNIVIHYVsreDVFNLQNGGPILAVLRQLGCVVDALLVFRTITRKV 268 Caenorhabditis elegans
Q5F4U4    213 LIDAANVIIFDFSPVLISFLFq--QWFSLQDFGPIGVVSKMWGCATEALLVFGTFRKPS 269 Caenorhabditis elegans
NP_503593 231 LIDAANVIIFHFSPILFAFLFk--HWFTAQNIGPIGVVSKMWGCALEALLVFGTLRKKS 287 Caenorhabditis elegans
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap