Conserved Protein Domain Family
DUF3808

?
pfam10300: DUF3808 
Protein of unknown function (DUF3808)
This is a family of proteins conserved from fungi to humans. Members of this family also carry a TPR_2 domain pfam07719 at their C-terminus.
Statistics
?
PSSM-Id: 402081
View PSSM: pfam10300
Aligned: 18 rows
Threshold Bit Score: 447.194
Threshold Setting Gi: 122105444
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
A7TST2  37 LQAMDYVLDDRAEEGLALLKknEAedgSDQ-TIN-VLARGVIEFLEATLGFEAEEMKKASETLAKAENLSLKSRQYAQKN 114 Vanderwaltozyma polys...
Q8VE09  31 LAGINMLLNNGFRESDQLFK--QY---RNHsPLM-SFGASFVSFLNAMMTFEEEKMQLACDDLKTTEKLCE--SEEAGVI 102 house mouse
Q16TQ6  18 KQGIALWLNNQPKAAEESFN-------NREsSVHiVAGHTFISFMNAVISWETEKMNEAQGLLRELEKKCA--GDIGWIK 88  yellow fever mosquito
O94699  16 IQGLNDILDDKMDEATEKFK-------SGNsSFH-LSGQAVVAFIQAVLTFEPSRFKDSQNRIDIAIKALSADKDDASKN 87  Schizosaccharomyces p...
A1CQ80  28 RDPATLILNDDVDGAEDGLa-------EGTsSFH-NLGRGVVAFIRATLGFEQDIMRQASERLNEAETTASVDQHRAQHN 99  Aspergillus clavatus ...
A2QQE8  32 MRAATLILNDDVDGAEDGLs-------EGTsSFH-NLGRGVVAFIRATLGFEQEIMRQASERLNAAETSAANDQHRAQHN 103 Aspergillus niger CBS...
Q6CG79  33 LAAIDTVMDERKEDAAPYLSi------KTNsGLH-KLVHGVVGSIEAFFGQDPEQIRQTADHLATCETAAYKNIDRTHNY 105 Yarrowia lipolytica
Q6CSC1  39 LQAMDYVLDDNAEVGLKLLAdnQAtspGDA-TVG-ALAKGVIEFLEATLGFEPEVMKKASTTLAEAEQLSLKSRAKLQKL 116 Kluyveromyces lactis ...
Q0VF76  69 TTGLYLFLNNRFSDAINLIH--PW---SKNsSYH-ALIYSMFMVVKAILTFEPQDIQIGMNAAKEALKTCNNFRKKPRIV 142 house mouse
Q28DB0  40 TLALNLFLNNKFSEALEILR--PW---AKEsIYH-ALGYSTILVMQSAMTFEPQDVQMGISTMKEALQTCQRFRKRTTVV 113 tropical clawed frog
A7TST2 115 Dlk--------ssS----LYAPGTVYAVTYTESCLLHALLMI-FSESYVETAKALLKLRKAYYMLQEIFEEMKKVKqtng 181 Vanderwaltozyma polys...
Q8VE09 103 EtiknkikknvdarkstpsmvdRLQRQIIIADCQVYLAVLSF-VKQELSAYIKGGWILRKAWKIYSKCYVDINALQelyq 181 house mouse
Q16TQ6  89 Tvrtklfgsy----epqktlasALEEQIILADTQLCLAILVS-LSQDIGGFVKGGWLLRKAWKVYQHTYSQIYQLYtktl 163 yellow fever mosquito
O94699  88 Ntf---------lS----TFDPGVEYRVSIGLMLLLSALIGF-CSESIVTSVKSVYKLRKAHSIFSKINKRHFDHFsaaf 153 Schizosaccharomyces p...
A1CQ80 100 Sqapn----tyhsA----MYTPGTEFALCQAMAQLMGAVVGV-LNESLTESIKGFYRLRKAYITLDAILKMEQKYLqesr 170 Aspergillus clavatus ...
A2QQE8 104 Shapn----tyhsQ----IYAPGTEFALCQAMAQLMSAVVGV-LNESLTESIKGFYRLRKAYITLDAILKMEQKFImqar 174 Aspergillus niger CBS...
Q6CG79 106 Tp----------yC----SYPPGTEYKVALAEAELLGACMMI-ISESMLEMTKALYKLKKAYSTLYEIQQMKKNPNytpy 170 Yarrowia lipolytica
Q6CSC1 117 Nik--------tsS----LYPPGTEYAVTYTESCLLHALLML-FSESMVEGAKALFKLRKAYHMLQDILKEINASEkrkr 183 Kluyveromyces lactis ...
Q0VF76 143 tlsrlm-srqgikS----IKEEELHAEVCYAECLVLKSAITFiQDDSLLSFLKSGVNVGSSYQIYKDCQQVLE------- 210 house mouse
Q28DB0 114 EslsnlvskqsgdQ----LTEEEMHAEICYAECLLQKATLTFvQDENMINFIKGGMKIRTSYQIYKECHQLYSLAV---- 185 tropical clawed frog
A7TST2 182 nmsiyksetnhseasvdssnasfssvdipyeltreesnnslyqesaekvqkmrvrrltgshigntpaidrlrselgldgp 261 Vanderwaltozyma polys...
Q8VE09 182 kkl----------------------------------------------------------------------------- 184 house mouse
Q16TQ6 164 sp------------------------------------------------------------------------------ 165 yellow fever mosquito
O94699 154 hst----------------------------------------------------------------------------- 156 Schizosaccharomyces p...
A1CQ80 171 matpiesaapgsiplsmkrqgssnlqsssssissakikkaa-------ssattlaapventdlserltglnlssetlapg 243 Aspergillus clavatus ...
A2QQE8 175 nsgnststeslprgagqgagsksvpas------------------------------------pvepidlkkelsdlsis 218 Aspergillus niger CBS...
Q6CG79 171 sytpaelteyaka------------------------------------------------------------------- 183 Yarrowia lipolytica
Q6CSC1 184 ssiylqeinestasfissgtcftsydipykltpeeeqdkelldl-ankvyslrrkrlcgahignspainrlrddvgaasl 262 Kluyveromyces lactis ...
Q0VF76     --------------------------------------------------------------------------------     house mouse
Q28DB0     --------------------------------------------------------------------------------     tropical clawed frog
A7TST2 262 kvtteensneysALS--ENmdf---sqaTIDEFIHSGVNLCYGILQVVLSLLPSGIGAVLSVVGFHGSREDGLRLVWR-A 335 Vanderwaltozyma polys...
Q8VE09 185 ------teeplaSDAanDNhvvaegvteESLSRLKGAVSFGYGLFHLCISMVPPNLLKIINLLGFPGDRLQGLSSLTY-A 257 house mouse
Q16TQ6 166 ------ppepanHDVggTTteditqikpEDVRRLMGAVSFGYGVFQLSISLLPPSLLKLISFLGFEGDRSMGVACLMH-S 238 yellow fever mosquito
O94699 157 ----------------------grsdvdLANEYVQTGTLLCTGLFTLLISLLPPKMITILNVFGYKGDRDWALQCMWMpA 214 Schizosaccharomyces p...
A1CQ80 244 dvkeastlgpadmLNhdPDsdi---fhnQIDIFVHSGSNFCFGILLLLISMVPPAFSKLLSIIGFHGDKERGLRMLWQ-A 319 Aspergillus clavatus ...
A2QQE8 219 adseasasgpsdmLShdPDsdi---fknQIDVFVHSGANFCFGILLLLISMVPPAFSKLLGIIGFHGDKERGLRMLWQ-A 294 Aspergillus niger CBS...
Q6CG79 184 ------------rharlgpkvsannvgesYDELIDTGFRLCFGIIQVVFSMIPPGLSKLLSAIGFKCSREDGLRLLWE-S 250 Yarrowia lipolytica
Q6CSC1 263 kkgsdeetqefqLLS--DNani---nqaTMDEFIHSGVNLCFGILQVVLSLIPPAIGAVLSVVGFHGSREEGLRLVWK-S 336 Kluyveromyces lactis ...
Q0VF76 211 ------------LMPenQS---------KTHRHLIGGIKFGVGVFNLMFSLVPPKSLKLLNMVGYSGDREVGLALLHD-S 268 house mouse
Q28DB0 186 ------------TQGktCS---------DTHHQFEGGVKLGIGAFNLMLSLLPSRVLRLLEFIGFSGNREFGLSQLRE-G 243 tropical clawed frog
A7TST2 336 TK-QRNIHGCIGLLGLMFYYDGPFQFTDAdfdipvpenelkktkssstyeegdldgptLLHPGKILEDALLQSRALFPHS 414 Vanderwaltozyma polys...
Q8VE09 258 SE-SKDMKAPLATLALLWYHTVVRPFFALdg-------------------------sdNKGGLDEAKAILLRKESAYPNS 311 house mouse
Q16TQ6 239 RS-SVDMRAPLSTLALLWYYTIVTPFFALdg-------------------------snLKFEICSAQELIEESTE-FSKS 291 yellow fever mosquito
O94699 215 LQrPTSFFAAVAFAALIQYYSGAVQLCSIykktp---------------------eepdGWPDKRCFEILEKVEKAHPDG 273 Schizosaccharomyces p...
A1CQ80 320 SK-FHNLIGAIAAFSVLGYYNGFVRYCDImpdsip-----------------gqdedvQGYPQERLELLLAKMRKQFPKS 381 Aspergillus clavatus ...
A2QQE8 295 SK-FHNLIGALAAFSILGYSNGFVRYCDImpdpv-------------------pgddvQGYPQERLEALLALMRKRFPKS 354 Aspergillus niger CBS...
Q6CG79 251 IS-APNVQATVALVVLMRYYDSPMQSSDLilpgteeeliak---------gsffekksedsPRSRMYQQLMVARARYPRS 320 Yarrowia lipolytica
Q6CSC1 337 TK-DRNIHGGIGLLGLLFYYDGPFQFTDIdfdipaarddn--------lpvtemdrptLLHPGKILTSALLQARALFPNS 407 Kluyveromyces lactis ...
Q0VF76 269 AS-EPHINNILSVFTLLFYYNYVRVVVGV-----------------------------EKASTAATESLFLIYLEKFPNC 318 house mouse
Q28DB0 244 AS-GNSIRAILCVLTLLFYHTYISTILGT-----------------------------GEANLEEAEALLEPYLKKFPNG 293 tropical clawed frog
A7TST2 415 ALWLLNEATMLSGQGRLRDSVKLMDSIe-ADKIEMRQVKSLLIFNRALTLVHLHEYERAADDFLSLLDISSWSHSLYHYF 493 Vanderwaltozyma polys...
Q8VE09 312 SLFMFFKGRIQRLECQINSALTSFHTAl-ELAVDQREIQHVCLYEIGWCSMIELNFKDAFDSFERLKNESRWSQCYYAYL 390 house mouse
Q16TQ6 292 SLFLFFRGRVERLKSNIKEAIQAYEFAy--rSSAQREIKLLCLHEIGWCRLIQLDYGTAMNNFKDLRRCSQFSKSFYAYL 369 yellow fever mosquito
O94699 274 PMWPLHRAKLLSMVKKQDEAIVVLEELmaKPPPRLKQLEVLIVFEHALDCAFSHRYVDGANSFLKLSSLNDSSTALYSYF 353 Schizosaccharomyces p...
A1CQ80 382 QLWVLEESRMCGANKNLDRALELLCg---GESSPLKQVEALRLFERSLNAMYLHKYELCAASFLECFELNTWSRSLYYYI 458 Aspergillus clavatus ...
A2QQE8 355 QLWLLEESRMNGANKKLDVALELLCg---EDRSPLKQVEALRVFERSLNAMYLHRYELCAESFLECVELNSWSRSLYYYI 431 Aspergillus niger CBS...
Q6CG79 321 SILVLQQGQAEATLHRLDEAIAILSVd--LNTVHMRQLKEPIYENRTKWLTCLHQYRTSANSFVELVDLTPKCHAWYNYL 398 Yarrowia lipolytica
Q6CSC1 408 ALWLLQEARMLSKQGRLKEAVDLLDSId-HNTIEMKQVKALIVFEKATTLVYMHEFERGAETMLIMLSISEWSHALYTYF 486 Kluyveromyces lactis ...
Q0VF76 319 VVLKFFRARFNMLNGNFESAKLKLQECi-ITQNEWKQVHHLCYWELMWCHIFLQNWKQAYNYASLLFQHSRWSKAIYIYS 397 house mouse
Q28DB0 294 SIILFYAARIDILKGRFEQAQETFQKCi-VSQQEWKQIHHLCYWELMWCHSFQQDWLQAYRYADLLCKESKWSKATYVFQ 372 tropical clawed frog
A7TST2 494 AGSCYLEIYRMhqlg----vrksDRPEHFkQRATDLIFGAPNLLTRKSFnaRPLPLDRFMLRKVDQFKATqkrlkl-sdp 568 Vanderwaltozyma polys...
Q8VE09 391 TAVCQGATGDV-------------------DGAQLVFKEVQKLFKR-----KNNQIEQFSVKKAERFRKQtp-------- 438 house mouse
Q16TQ6 370 TVICQGAHGYF-------------------DELTKWRSEISELLSRSSQ--KESQIEKYIYRRCQKLPKsetet---ekf 425 yellow fever mosquito
O94699 354 AAACFLQDVHV------------NANVEAlEKASKLLEPLHDLVAN-----KTAPLDVHIRRKVGKLIKRrasagnqggl 416 Schizosaccharomyces p...
A1CQ80 459 TGSCHLSLYRNald------kdpAKAAEHaELAEKYFRLAPPLAGKKRFmaRQLPFDVFVARKVAKWEARakdwk--vpl 530 Aspergillus clavatus ...
A2QQE8 432 AGSAHLSLYRNiag------tdaTAAAKHaEKAVEYFRKAPPLAGKKKFmaRQLPFDVFVSRKIAKWEARakewk--vpl 503 Aspergillus niger CBS...
Q6CG79 399 AACCLLEVYKE------------EEDPAAkAQAGVLLEKAATHASD-----KKQHLRKYVAHRIQQLKKEgpl------v 455 Yarrowia lipolytica
Q6CSC1 487 AGCCYLEMFRKyemgilngenaaEKKAYYkERATNLVFESANMVGKKKFmsKILPLDRFLLRKVDQFKKFqniiks-sdp 565 Kluyveromyces lactis ...
Q0VF76 398 KAIILALIPPD------------CVDSEN-ESLSSYFLRVDSLRIKILG--SSVPIEKFIAEKSQRYGTTt--------- 453 house mouse
Q28DB0 373 KAAILSMLPDD------------VVKTTG-EDIVALFRQVEGLKQRIAG--KSIPTEKFAVRKSRRYASDn--------- 428 tropical clawed frog
A7TST2 569 ldAIATSPVHELQYFYNGYNRMGKQDLE-LANIML-----------TEyhnpaidaKepNQEM-----IKDFLVSLTYRR 631 Vanderwaltozyma polys...
Q8VE09 439 trALCVLASIEVLYLWKALPNCSFPNLQrMSQACHe----------------------vDDSSvv--gLKHLLLGAIHKC 494 house mouse
Q16TQ6 426 dcGYWRLLVYEMLFMWNALSSCSEETLSeVIEDCCks---------------------qDESTepsqgLRQLILGASLGC 484 yellow fever mosquito
O94699 417 aeYVGFSPLYELVYVWNGFRRMTDDELSkFDVERMepw------------------qdqDDDI-----CQALIKATVLRN 473 Schizosaccharomyces p...
A1CQ80 531 vdAVGVDPIEEMIFFWNGHSRMTDEHLL-ESLQKLawce---ssanKTws-----rEgpEEKA-----ILKLLRAAVFRS 596 Aspergillus clavatus ...
A2QQE8 504 vdAVGVDPIEEMIFFWNGHSRMTQEQLE-ESMTKLawse---seanKTws-----rEgpEEKA-----ILQLLRAAVLRA 569 Aspergillus niger CBS...
Q6CG79 456 dvAVKKPLLGEVFYYWNGYSKMPQNALE-KSYKKLng--------------------mnDPQS-------ALLQAVILRN 507 Yarrowia lipolytica
Q6CSC1 566 ldSIGVSPVHELIYFYNGYNRMTMKELN-LSLKSL-----------TEyrnptidlQnpDQEL-----IKDLLTSLVLRR 628 Kluyveromyces lactis ...
Q0VF76 454 -gWFTAQPLLEFIYAWSGFRVMSKKIELiSSWLLIidkgkellsenPNee----ygI--DDMS-----LLNLLKGLCLKH 521 house mouse
Q28DB0 429 -pVKLTLPALEMVYVWNGFTIVGKRPDLtENVLVTiekaevalqseKNpse---yhP--DDLC-----LVQLLKGVCLKH 497 tropical clawed frog
A7TST2 632 L 632 Vanderwaltozyma polyspora DSM 70294
Q8VE09 495 L 495 house mouse
Q16TQ6 485 G 485 yellow fever mosquito
O94699 474 L 474 Schizosaccharomyces pombe 972h-
A1CQ80 597 L 597 Aspergillus clavatus NRRL 1
A2QQE8 570 M 570 Aspergillus niger CBS 513.88
Q6CG79 508 L 508 Yarrowia lipolytica
Q6CSC1 629 T 629 Kluyveromyces lactis NRRL Y-1140
Q0VF76 522 L 522 house mouse
Q28DB0 498 L 498 tropical clawed frog
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap