Conserved Protein Domain Family
7TM_GPCR_Srab

?
pfam10292: 7TM_GPCR_Srab 
Serpentine type 7TM GPCR receptor class ab chemoreceptor
Chemoreception is mediated in Caenorhabditis elegans by members of the seven-transmembrane G-protein-coupled receptor class (7TM GPCRs) of proteins which are of the serpentine type. Srab is part of the Sra superfamily of chemoreceptors. Chemoperception is one of the central senses of soil nematodes like C. elegans which are otherwise 'blind' and 'deaf'. The expression pattern of the srab genes is biologically intriguing. Of the six promoters successfully expressed in transgenic organisms, one was exclusively expressed in the tail phasmid neurons, two were exclusively expressed in a head amphid neuron, and two were expressed both in the head and tail neurons as well as a limited number of other cells.
Statistics
?
PSSM-Id: 370953
View PSSM: pfam10292
Aligned: 17 rows
Threshold Bit Score: 341.169
Threshold Setting Gi: 75012547
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
O16278         6 STVCETMLTYSKSVELRLSLLINWFIMLPSFPIIGYS---FFYCWTRRLFHKNTQLQVIIHLGGLLIHCFGRFSLHTLDL 82  Caenorhabditis ...
Q7YWP3         5 QQTCDLMKDIATFPPLSALLLSFLILSILILPLMGWL---ITRIAKNQLYHLNTRILLIIHCSGIFIHCADRLFLHTSDL 81  Caenorhabditis ...
Q5WRN5         2 NSNCTTMLTLSSSTALKTSMAFNLTIALIGFPLFGWSslkLWTGAYTQNFHKNLRIIAQMHLTGFLLHCSGRIMLHSLDL 81  Caenorhabditis ...
Q22383         3 NVDCNKMAEIASSGFLRFSLVFNLVITICAVPVLIWAtwkLWSMKYTKLFHVNFKIIIQLHLFGFMLHCSGRIILHSIDL 82  Caenorhabditis ...
Q22382         3 SINCTIMANLSNSNFLRVSLGINLIICILGLPVFLVYtwkIWSAKNSSLFHVNFKIILQLHLFGFILHVTGRTVLHGLDL 82  Caenorhabditis ...
Q9GZD2         4 ETDCQEMAIVATSSFLRAVLLIAVLLCIMCIPISIYS---LWRIYFSVKLHFNSKIVLFTNNTFVLIHCLARIVLHGKDL 80  Caenorhabditis ...
Q9GZD4         4 ETDCQVMAEVATSSFLRTSLGMTTLLCILCVPCTIYS---FLAIQKATKLHFNSKCIFHTLTIFAFIHMIVRIILHGKDL 80  Caenorhabditis ...
O45308         9 VFNCSEMLQVANSRFLRSVLYFNLFCSAVAVFYLIHT---WLSICRYKLMHFNLKFLMKIHCAALLIHCVPRFFLHLFDL 85  Caenorhabditis ...
XP_002635612   2 ACDKKLVAKIVDSNILTFVETFMLILSTISIPVLFHM---FQRCKNSKLFHFNIRLISAFHCLCLIIHCVARVFQHGSDL 78  Caenorhabditis ...
O61200         8 VCDVREVLKYQDSKFLHYSELIMLILSFIALPILILA---IVKCIKSSLFHTNIRLITGFHCFFILIHCFGRILQHSSDM 84  Caenorhabditis ...
O16278        83 FNYFHPh--TDGCDILPNFYRCLILRFFYNSGQALISMTPLSIILERLIAVGYNRAYENCSINYgVLLGALQIALAIAYL 160 Caenorhabditis ...
Q7YWP3        82 YNWHVAmyeTSSCDIISTSERCFGLRLFLNIGLFIAIYTMPTLVLERYLALRQVATYQKNRTAW-TWLVMFQLCLSTWFL 160 Caenorhabditis ...
Q5WRN5        82 YNYTF----LNPCAMIPNIYRCFTLRLMYNFGMWVTMCTAVPLVLERTLATHLKGRYENKRIWYgILFASLHVFLAAAPL 157 Caenorhabditis ...
Q22383        83 FNYTTQ---DNPCDMVPNIYRCFVLRLMYNTGLWITNSTAVSLIIERWLATKRSATYEQESVRMgIFLAFFQFAVTSIPL 159 Caenorhabditis ...
Q22382        83 FNYLTL---LDPCQMIPNIYRCFVFRLMYNSGLWITNSTAVSLILERWLATKRSMTYEKDSTIIgLLLAIVHFLIAALPL 159 Caenorhabditis ...
Q9GZD2        81 LNYFDNw--SSGCDILPSRARC-HVRFIYRFGEYIIEISPFILLIERFIATFKADSYENRRKLYgIIFFITHISIAIMFL 157 Caenorhabditis ...
Q9GZD4        81 LNYVGPw--MSGCEIFPSRSRC-ELRKLYKISAFVVEVTPFVLTAERFVATFRARHYENRYKWCgVLLNIFHISLALFLF 157 Caenorhabditis ...
O45308        86 YYYFFG---VDCYDMQPSSLRCFILRFPYMFGLILSSTTTIFLMIERGFATYYSQHYEHGYKSIgVIIAIFQLLCSLILM 162 Caenorhabditis ...
XP_002635612  79 FLYFSH---IPICEKVPSIQRCLSTRIPYIFGLFCASYSTVFMVIERTIATKSYKKYENRHKTLgCMLILGQIFMGGATT 155 Caenorhabditis ...
O61200        85 YLWMAP---LAVCEKRQYFEICVISRSMYLYGIYSSSFTTVFMAIERTLATYLSHKYEHKNSCVgILLVCFQIIISLLIT 161 Caenorhabditis ...
O16278       161 TTRYIHAAFrpaSFTFFYCQTLVSStiSTNETYIPLLLIIVSHIVSILIFRCLEIKNKKLRE---VVDINLSTRYTLDQG 237 Caenorhabditis ...
Q7YWP3       161 GLIYSQTTF---GGTTVYCIAAREA--IPFNMLLAFSMSIVVQTVSYIGFRYLVHKNKNLKVslqNRGSALTKRYQVEES 235 Caenorhabditis ...
Q5WRN5       158 MIAYSNTKFd--GVFMPYCNIYMPG--HPEIANANSIIAITVQILARISFGCLFHVNKNLRSs--MQRSSLSTRFQLEQN 231 Caenorhabditis ...
Q22383       160 AVLYSKIQFe--GVVMYYCVTAQAS--LPYVGQMSAVVGFVFQVSARISFHYLYKQNKHIRNt-gVHHSTLSNRYQLEQN 234 Caenorhabditis ...
Q22382       160 CFLYSQTRFd--GAVMYYCVTATPS--APYSAQVGATVSICFQVVARIAFEFLLRENKKHKEf--DVQSPLSNRYQLEQN 233 Caenorhabditis ...
Q9GZD2       158 YFDTDFTGG---AIMIFFCWTSTSA--NRLSVNIPTFFIFFTQLATIPGLLYLLRKNEELRAsslHKHSTLTERYQISEN 232 Caenorhabditis ...
Q9GZD4       158 TIQSSEKVG---GDIIYYCWMSSTG--NRYMLNLPIFVIVFSQLITIPALLYLLRKNEKFREaslQKRSTLSQRYQLSQN 232 Caenorhabditis ...
O45308       163 ASVFHEYDF---DAPHYYCSSISVK--FPLWVIIPEVLIIVFQIAARIVNRCLLALNKRIRAr--SVTATLSNRYQLEAN 235 Caenorhabditis ...
XP_002635612 156 FAIFYKFDF---QNAQEFCTGSQSS--DPYFLIIPEAVAILSNVLAFFQFGRLMSINRKIRVg--SSSNNLSQKYQIEEN 228 Caenorhabditis ...
O61200       162 VPLFLDSKF---TTRPDFCEFHDPS----DWLLVVEIFTIFSNFVAFLQCWKLYRVNTKLRVh--SKVRRLSQKYQIEEN 232 Caenorhabditis ...
O16278       238 RRSFIALKCFISYNCLMVSLITAGLMFLHLVSSHFSKPNYMAIIEMTHAIPLYGMIVCIAVYWKLRTIDGEQRRNITMAL 317 Caenorhabditis ...
Q7YWP3       236 LRSLETIAFPIQMMYFFEVFHSLSSFLFLNFNAHLSKPWYYFWMEISACLPEYAIAFLIAFVLQEKRLERKGITSLRKEM 315 Caenorhabditis ...
Q5WRN5       232 KNSMQCLKIYANTSTIFLLIQIPSFGWIL--NEKFRPEYYLALQELNCAFPSYGIITVFLVSRKIFSVHNQIHSSLESQM 309 Caenorhabditis ...
Q22383       235 ISSITCLKTFAGISTTFIVIYNIIYIVLMFHANDLEPYQYFGILELNLAFPSYAIVSIIILSRSMKKVRKLIGVQLVAHL 314 Caenorhabditis ...
Q22382       234 ISSITALKTFANMSVTYIIFQNLCYITLMYYGIQLERAQYLAILELNGSWPLYGVVSIMIFGKTIRKIHGKIKQSLHGHI 313 Caenorhabditis ...
Q9GZD2       233 LRTSTMFRIMSVVTWVYVAYKAIGSYMMY-FIESVLLPDLFAITEVIHCLPLYYIILAALITRVDRKPRSEF--KVNNYE 309 Caenorhabditis ...
Q9GZD4       233 LQTLTKFRIVSTVTWIYVTYNAAATFGVHFFLKSMSSAGQFAIIEIVHCLPLYYLILIFLMVKEDKKPHRQFSIKVDHYE 312 Caenorhabditis ...
O45308       236 MRNIRLLQSFTLCDLIFVFTCFTLSAPVHYYSSEMERPTYHALVEVVNFVPLYSVVMPLYLWVFQKKHRDTVSNTLQASL 315 Caenorhabditis ...
XP_002635612 229 LNVVNILRAFTKCDFIFILIYFTMGIPFHLIGKHMDSAEYYALFEVIYFVPLYSLIMPAYIYRFSRKQRDERMTRMERKI 308 Caenorhabditis ...
O61200       233 KMLIKVILRFTCLDFVFMMVYCFGNLATNFIDFSLSQGKLHGFIEMVHCLPVYAIVVTYSMARVIKHIQKRKTSNLVAEI 312 Caenorhabditis ...
O16278       318 RGQAVHtdlYFQMFEK---QLN 336 Caenorhabditis elegans
Q7YWP3       316 QVNPEN---YFDQYRK---SWT 331 Caenorhabditis elegans
Q5WRN5       310 KLQGEIt--YFEHFNQ---QIS 326 Caenorhabditis elegans
Q22383       315 KTPNQQ---YLDNFKR---QIA 330 Caenorhabditis elegans
Q22382       314 KLPNHM---YLDVFKR---QIA 329 Caenorhabditis elegans
Q9GZD2       310 THHFVElhkFFDGAFErkqQVG 331 Caenorhabditis elegans
Q9GZD4       313 PQYFNDlqkFFDQSFD---KVK 331 Caenorhabditis elegans
O45308       316 TTSSDH---YFNVLNQ---QLS 331 Caenorhabditis elegans
XP_002635612 309 QVSEDA---YFQFIHN---QWT 324 Caenorhabditis briggsae
O61200       313 RIREDA---YFSYINN---QWT 328 Caenorhabditis elegans
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap