Conserved Protein Domain Family
Luciferase_cat

?
pfam10285: Luciferase_cat 
Luciferase catalytic domain
This domain is the catalytic domain of dinoflagellate luciferase. Luciferase is involved in catalyzing the light emitting reaction in bioluminescence. The structure of this domain has been solved. The core part of the domain is a 10 stranded beta barrel that is structurally similar to lipocalins and FABP.
Statistics
?
PSSM-Id: 118809
View PSSM: pfam10285
Aligned: 3 rows
Threshold Bit Score: 661.284
Threshold Setting Gi: 75099644
Created: 11-May-2020
Updated: 6-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
O77206  191 PLCADPFSPEIEQLCQALVREAQDDKTLCFENFTKPCPQLTKKQVELCKGFDYGDKTLKLPCGPLPWPAGLPEPGYVPKT 270  Lingulodinium polyedra
O77206  568 PLCKDPYGKEVQSMVENLLVQANVDTTNAFDNFKQPCPQLTKEQVAMCKGFDYGDKTLKLPCGPLPWPAGLPEPGYVPKT 647  Lingulodinium polyedra
Q5UAZ6  936 PLCKDPYGPEVSALVEKLLKEAEDDRTLCYNNFQDPCPELPKEQVAKCKGFDYGDKTLKLPCGPLPWPAGCPEPGYVPKT 1015 Alexandrium tamarense
O77206  271 NPLHGRWITVSGGQAAFIKEAIKAGMLGAAESHKIMADTDHHQTGGMYLRINQNGDVCTVDASVAKFARAKRTWKSGHYF 350  Lingulodinium polyedra
O77206  648 NPLHGRWITVSGGQVAFIKEAIKSGMLGAAEAKKIIADTDHHQTGGMYLRINQYGEVCTVDASVAKFARAKRTWKSGHYF 727  Lingulodinium polyedra
Q5UAZ6 1016 NPLHGRWITVSGGQAAFIKEAIKSGMLGQAEAHKIMADTDHQKTGGMYLRINQFGDQCTVDASVAKYARAKRTWRSGHYF 1095 Alexandrium tamarense
O77206  351 YEPLVSGGNLLGVWVLPEEYRKIGFFWEMESGRCFRIERRAFERNGLMIMRQATEVAGKISFVFYVKVSNDPESKPIPLQ 430  Lingulodinium polyedra
O77206  728 YEPLVSGGNLLGVWVLPEEYRKIGFFWEMESGHCFRIERRAFPCGPYMFLRQATEVGGKISYVFYVKVSNDPGSKPIPLQ 807  Lingulodinium polyedra
Q5UAZ6 1096 YEPLVSGGNLLGVWVLPEEYRKIGFFWEMESGKCFRIERRAFQAGPYTFLRQSTEVAGKISFVLYVKVSNDPGSEPIPVQ 1175 Alexandrium tamarense
O77206  431 SRDYTALAGLDNVPDSLGNPYTCEAKDLDYPIKRDTWLDKNQEEMLKQRSIVGTAF 486  Lingulodinium polyedra
O77206  808 SRDYTALAGQDNAPDNLGKPYKCTARDLDAPTKRDGWLDTNKGAMLDQREKVSKAF 863  Lingulodinium polyedra
Q5UAZ6 1176 SRDYTALAGCDNVCTNLGKPYPSTAKDLDYPKKRDAWLDQNKRQMLYQRDVVASTF 1231 Alexandrium tamarense
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap