Conserved Protein Domain Family
Tmemb_161AB

?
pfam10268: Tmemb_161AB 
Predicted transmembrane protein 161AB
Transmemb_161AB is a family of conserved proteins found from worms to humans. Members are putative transmembrane proteins but otherwise the function is not known.
Statistics
?
PSSM-Id: 402058
View PSSM: pfam10268
Aligned: 25 rows
Threshold Bit Score: 457.877
Threshold Setting Gi: 674576838
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
XP_002124040   2 AIFGFQLCFTLIMACFLQKLMPLFSFGRWLLCNGTLVRYKHPHDDELK----KLAKKPVE------------KVNGkG-- 63  vase tunicate
CDS37277       2 AILGYQLVSTLIGISLLTKLSVHFSFTSVFVFGG-IYRSLLPTNREIL----GSAGLTKI------------KSKGrRsn 64  Echinococcus mu...
XP_015785322   2 AILGIQLVVTMVMLSILHKFAIHYSFARWLLAHR-LIRYLQPTEQQIKrgvaALANERKAhqddknvkqsksKSNKqSsf 80  two-spotted spi...
EFX86498      43 AVLGVQLIVTLLTISIMQKVTQRFSFGKWILCKTGLVYYLHPTDAELR----KLAGLPQPkpkpkp-kegdnKRGK-H-- 114 common water flea
XP_001942992   3 tLLGIQLIITMIAINLIHRLSHIYSFARWTLCSTGLVRYLHPTDKELR----QLSGLKKK------------DSKL---- 62  pea aphid
EEB13811       2 ALLGTQLVLTLIMVSFIQKLGHHLSLGKWLLCSTGLIHYLHPTNEELR----SLAGIQKNn----------kNNKK-N-- 64  human body louse
XP_001607157   2 ALLGAQLVITLIMVSVIQKLGSHFSIAKWILCSTGLIRYLYPTDQELR----NLVGFPKDkh---------kKGK----- 63  jewel wasp
XP_006563429   2 ALLGAQLVITLIMVSVIQKLTPHFSLARWILCSTGLTRYLYPTDQQLR----ILAGVPKEks---------kKGK----- 63  honey bee
Q9VTF5         2 AVLGAQLVITLVMVSVIQKLSPHYSFAKWILCRTGLYRYLHPTDDELR----SRGGVPKEkp---------pKGGR-N-- 65  fruit fly
ESO12572       2 ALFGVQVVFSMIVAFLLSKFTGQYSFGRWILCRK-LARYLHPTDDELR----KIAGSSGQ------------GSNKqHnk 64  Helobdella robusta
XP_002124040  64 --RHRRNQQpTEE-KTFKVPRNIEISLEAEKINPVDVVVLRSYPDYEWLVDYSVFVMFVYVGTE---------------- 124 vase tunicate
CDS37277      65 gaGAGGSYEgRNDpATFYFPRSTPFKLRKAEVRGHEIAVLPFYTDLVWLVDFSLCALLVLFANDfvsffrhvlpptlstn 144 Echinococcus mu...
XP_015785322  81 rgKRGRSDKnKAD-ENL-VPKKLALTLEAERVHSIDLIQLNFYKEYHWLIDFALYATIVYIISE---------------- 142 two-spotted spi...
EFX86498     115 --KRKWAEEpVED-KTFTVPRNLDLQLETAKIFPKDVLQLKFFTEFVWLVDYSVFVLVVYLITE---------------- 175 common water flea
XP_001942992  63 --SKRPIHAqNDNiDIFQIPKNLDIELESQPIQEHEIYQLRYFMEYQWLVNFSLYAALVYLSTE---------------- 124 pea aphid
EEB13811      65 --RYGKDNEqQVL-DTFHVPRDLDIQLKKSKVVPLDVMHLRFYSEYQWLIDFSVYAVVIYTLTE---------------- 125 human body louse
XP_001607157  64 -----HAENgKTP-ETFQIPRNLDITLDTAPVTPLDIIHLKFYSDFQWLFDFSIYGVLVYIMTE---------------- 121 jewel wasp
XP_006563429  64 -----HTENgKVK-EVFHVPRNLDITLENTKITILDVVHLKYYTEYQWLLDFSIYATVVYVMTE---------------- 121 honey bee
Q9VTF5        66 --KQANGSGgAAG-AQFHIPRSIEVELLTSPVLERDVVHLRYFTEYQWLLDFSVYTGIVYVVSE---------------- 126 fruit fly
ESO12572      65 syKKLDPSKkAKD-ESFTIPKSADIQLEAVPIKPIDLLPLQYYGEYLWIVDVAVCGVIIFTLTD---------------- 127 Helobdella robusta
XP_002124040 125 --------VYYELWGP-EREFNISMIWVGLSVWFAVKNMISILWLYA-S--SK----------GGEISMSITFGMISFLC 182 vase tunicate
CDS37277     145 kttsfflsMHSFFTPS---TINLNLVWSLFIVWFAMGSLFSVLRVYLgRssDNeakvkeravsSSEWPLLMVTGFSSFIA 221 Echinococcus mu...
XP_015785322 143 --------IQFYLIPE-SKEMNLSLIWCILVIGFTTKLLLTITGIYFrGndDA----------IGERSMCLVSGGLFFLF 203 two-spotted spi...
EFX86498     176 --------VYCGVFPKgNQEVNLSMLWCLLLIGFALKSLCSVTSLYFwNt-EA----------AAERSLVLVGGSFCFVL 236 common water flea
XP_001942992 125 --------IYSYYSPI-DNEINLSMLWCSIVIVFAFKILMSLTLEYFrGgfES----------SGERSTVIVAACVHLVI 185 pea aphid
EEB13811     126 --------TYQLIFQA-QDEVNLSMLWCFLVVGFAMKVLLSLTGQYFqSe-DS-----------GERSTVIVTGFVYFVL 184 human body louse
XP_001607157 122 --------VYNNWYPI-KDEINLSMLWCCLVLGFAFKVLITLWIQYFkGe-ES----------IGERSTCIVTGFAYLLI 181 jewel wasp
XP_006563429 122 --------IYNYLYPI-KDEINLSMLWCSLVLGFAFKVLLSLWIQYFkGe-ES----------IGERSTCIVTGFAYLLI 181 honey bee
Q9VTF5       127 --------LFHFYYPL-RHEVNLSMVWCLLVIFFALKLLSSLTVLYFqSe-ES----------IGERSMVIVACLVYLLV 186 fruit fly
ESO12572     128 --------IYYFFLHP-SREVNLSIFWCLIIAMYSLKTLISLTSVYFkT--EQ----------SGERVLCLLFGFFFLVF 186 Helobdella robusta
XP_002124040 183 GLCVLMIKEDILEFGITSI-NMTQHNSTMVNQQFSL----------SGLKLLLAGFGALHGLLIAFPAIRMSQMYLHSLK 251 vase tunicate
CDS37277     222 AMLCLSLDVSFLDLRISPAyGNLTFSLSPEASGSSAms-------wgMFQACLAFYAAMVGVLFAFPSLQYGRIYVQTLR 294 Echinococcus mu...
XP_015785322 204 SMIVLIADENFLEFGLNPAySTFNSNAIQFFEAHGLhestkgvtskLLFKFWLAVWSGLIGALFIFPGIRFAQMHKDSLD 283 two-spotted spi...
EFX86498     237 ALGLLLIDESNLEIGLDAAySSFNKSASVFLERQSMdseg--paskLILKLCFAVWCGITGALFIFPGLRVSRMHLDALR 314 common water flea
XP_001942992 186 AMIILVIDESKLDVRLDTAyRSFNETSTAFLNNHGLssqg--paskLIVKFFLALWCAVTGAMFVFPGIRTAKMHWDCLR 263 pea aphid
EEB13811     185 AMIILIIDENSLELGLETAyKVFNKNAIAFLERQGIdssg--paskIVLKFFLALWCGIIGALFTFPGLRMARMHWDALN 262 human body louse
XP_001607157 182 AMMVLIVDENTLELGLDDAyASFNHTASIFLKNQGLsssg--paskLIVKFVLAVSCGFVGSLFTFPGLRMSKMHWDALK 259 jewel wasp
XP_006563429 182 AMTIFIVDENNLEIGLDKAyASFNHSASLFLNNQGLsstg--paskIIVKFFLALWCGLLGSLFTFPGLRMSKMHWDILR 259 honey bee
Q9VTF5       187 AMVVLIVDERILETGLEDAyASFNASASKFLTEQGLpssg--paskIVVKFFLAMGCGLLGSLFTFPGLRMAKMHWDSLK 264 fruit fly
ESO12572     187 AMAILIVDEGTLDLGLESSyLNFSKATIAFMESQGLephc--pismTMVRIVIAISCAIIGTTLTFPGIRLAKMHVDALR 264 Helobdella robusta
XP_002124040 252 YAK-----------GNNLLNLTLHFNFFAPLVIMFLWVKPLARDIMV---------------GPSL----------LTNE 295 vase tunicate
CDS37277     295 DPE-----------SSWLTRLLFNLNLIAPQLTLLLWVVPLTARLPAlllqhagvalggaqmSTTWlsfvvicaraLSSE 363 Echinococcus mu...
XP_015785322 284 YAA-----------GKPFQQFLFHTAFISPLLIILSWIKPIGRVYFS---------------EKVWpnr----gvlMAPV 333 two-spotted spi...
EFX86498     315 YCS-----------ERKVLKIFMYINLVSPFLLSLLWVRPLARHYFS---------------VRIFgnme---aplMNDA 365 common water flea
XP_001942992 264 YYEcnevhgkyfsySSTFIKGFMNFSLITHFLLVLLWVKPIAVDLLT---------------AKNLsgln---kplMTLE 325 pea aphid
EEB13811     263 YCT-----------DKKALKILLNVNFAMPFFITILWIKPISRDYLT---------------NRIFhgms---hplMSST 313 human body louse
XP_001607157 260 YHR-----------DNKLLLLLMNLSYASPLILASLWIKPISRDYLT---------------VRVFssmt---kpiMTAA 310 jewel wasp
XP_006563429 260 YYK-----------DQKLLLLIANISYASPLLLISLWIKPISRDYLT---------------IRIFsgms---gplMTTS 310 honey bee
Q9VTF5       265 YCR-----------GNRLLQVLLNLSFVLPFILVILWIRPISRDYLT---------------VRVFqgmq---qplLKPH 315 fruit fly
ESO12572     265 YAK-----------ESPGTSAMLYMNFIFTLLLSLLWVKPLFRDYFV---------------VKKLknn----qplMTDY 314 Helobdella robusta
XP_002124040 296 QFEIFRIIFILLACVLRLCLTRVHLQAYLNLAFDKLNKIKKESGLITNIELQRTIAHVFYYLGIVAMQYLSPLVLLLCST 375 vase tunicate
CDS37277     364 RICSLRLLFTLFTVILRVAMTKRHMQAFLDTAQTRLDRLNREPGCITNREVQRIVASVFHCFNFAALQYLAPAMLLIGLA 443 Echinococcus mu...
XP_015785322 334 SFDTLRIVIILAIMIFRIILMPKYLQAYLNLAPRKLSKLTRESGKVKTEVIQRTVSGVFYYLCVVCLQYVCPLLLILFTC 413 two-spotted spi...
EFX86498     366 TFDSMRLWLCVVFSIVRIVSAPSCFQAYLNLAQEKIENMKKEAGRISNVDLQRKIAIIFYYLCVVGLQFVAPVILCVGFT 445 common water flea
XP_001942992 326 QFESLRCWLVVLVVFQRLYLMPTFMQAYLNMAHERLEQQKKEAGRITNKDLQKQVSVIFYYTCVVVLQYVIPLVMMLFFI 405 pea aphid
EEB13811     314 SFESLRLVIVLLAVTLHFCFMPLYLQCYLNMANSRIERIKKEAGRITNTDLQKRIAAVFYYLCVVALQYTAPILICLFLT 393 human body louse
XP_001607157 311 AFESMRLIAIIVAVVLKLLLMPTYFQAYLNLANQRLEVQKKEAGRISNIEFQKKIAAVFYYLCVVALQYIAPLIICLYCT 390 jewel wasp
XP_006563429 311 TFESMRLIAIIVAVLLKFLLMPIYLQSYLNLAMQRLENQKKEAGRITNIDLQKKIAAIFYYLCVVALQFIVPIIICLFFT 390 honey bee
Q9VTF5       316 VFETLRLLLVIFVVVVRFALMPIYLQSYLNLAHDKIMDLRKEAGRITNVEFKQKISSIFYYLCVVTLQFAAPLILCLYLT 395 fruit fly
ESO12572     315 QFEALRLLIILIFCVFRFLLVWVHLQAHLNMACDKVAELKKEVGRISSVELKKLVTRIYFYLCIVALHYLTPLILILFCT 394 Helobdella robusta
XP_002124040 376 LCLKSLGGFS------------------------------WKQVSTNYVQNI--------PSSNVTSANVSQDSTFVEMV 417 vase tunicate
CDS37277     444 FSYKASTGTG------------------------------WLP-----------------------------LAPQINVA 464 Echinococcus mu...
XP_015785322 414 ILMKNLGDYQ------------------------------WLSLFTG-------------------QSTGVSEAYIFGSS 444 two-spotted spi...
EFX86498     446 LMNKTLGGYG------------------------------WFGQHHYNPDECdpq---qePKATLSTLLPNDETTLVDAR 492 common water flea
XP_001942992 406 FFYKTLGNFS------------------------------WVEVIVNS-----------------SPTIDNSNQHSLLEA 438 pea aphid
EEB13811     394 FMYKTLGGFT------------------------------WTGDILKSEYECpsdt-yksAKENKFLYDN---FSIKASA 439 human body louse
XP_001607157 391 LMYKTLGGYS------------------------------WEGLYKNLDLENcsa---pePLPEPAIFSENEEKTVAQTA 437 jewel wasp
XP_006563429 391 FMYKTLGGYT------------------------------WEGLLKAPSPEEcpad-qlpKFISDVINDYDNEKTVVQTA 439 honey bee
Q9VTF5       396 LMYKSLGGFS------------------------------WSGIFRESVVLQhecaasetEGAGVAVSQGDGDFNIIESA 445 fruit fly
ESO12572     395 LLLKTLGNFSiphlllgtalyepaskslqsnqlfnitkhlWDS--------------------------ESTGDLIVNTA 448 Helobdella robusta
XP_002124040 418 SSFNSGLHDI---------TDVFTIELL-------------------------RGVCSFIAWWVSTNWFIASCLGLLYHS 463 vase tunicate
CDS37277     465 SSPSTSLASLietfagqdwDLIFTASWFsalqhtreafgelweslrcqagyvcQGVLGFALFWCLAAWQAVAVTGVAYHR 544 Echinococcus mu...
XP_015785322 445 EQFS--LKEL---------RAVFNPVFF-------------------------RGVLGYMSWWLSVVWFTTSVIGFIYHS 488 two-spotted spi...
EFX86498     493 EQWLAALSTF---------HQIFSYEVF-------------------------RGIFGFANWWMQFLSFFTIGCGLAYQS 538 common water flea
XP_001942992 439 NQAYFSIQSL---------KQVLTADVY-------------------------RGIFGFATWWICFSWFLSLSVGIFYQS 484 pea aphid
EEB13811     440 HQFTLALESL---------KQVFTVEVF-------------------------RGLFGLTTWWTYFAWFATTSVGMVYQS 485 human body louse
XP_001607157 438 QEFHLALSSI---------KQIFTIEVF-------------------------RGIFGLATWWTCFTLFATTAMGMLYQS 483 jewel wasp
XP_006563429 440 QDFQLTLSSL---------KQIFTVDVY-------------------------RGLLGLATWWSCFSLFATTAMGMFYQS 485 honey bee
Q9VTF5       446 QSLQASFSSL---------KNVFSTEVY-------------------------KGFLGFATWWSYFTLFATSSLGIVYQS 491 fruit fly
ESO12572     449 TQFSSIVAQI---------KMLFPTSCY-------------------------YNLISFYCWWVCVAWFTTTSFGVLYHT 494 Helobdella robusta
XP_002124040 464 YLV 466 vase tunicate
CDS37277     545 FVd 547 Echinococcus multilocularis
XP_015785322 489 YFS 491 two-spotted spider mite
EFX86498     539 YFF 541 common water flea
XP_001942992 485 YLS 487 pea aphid
EEB13811     486 YFT 488 human body louse
XP_001607157 484 YFT 486 jewel wasp
XP_006563429 486 YFS 488 honey bee
Q9VTF5       492 YFN 494 fruit fly
ESO12572     495 YFN 497 Helobdella robusta
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap