Conserved Protein Domain Family
Tmemb_cc2

?
pfam10267: Tmemb_cc2 
Predicted transmembrane and coiled-coil 2 protein
This family of transmembrane coiled-coil containing proteins is conserved from worms to humans. Its function is unknown.
Statistics
?
PSSM-Id: 402057
View PSSM: pfam10267
Aligned: 34 rows
Threshold Bit Score: 248.04
Threshold Setting Gi: 620976193
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
XP_015782805  50 KAAIEHYQAKIMRTKEAIKAEQTSRDENVNEYLKLAANA--------DKVQTQRIKSMFEKKNQKSAHTIAQLQKKLDSY 121 two-spotted spi...
XP_014347179 239 RAAQRHLQQKILRLVEQIRVEETERDQNLSEYLQMANNV--------EKRQAFRIKQTFEHRNQKSAAAIAQLQHRLEHY 310 coelacanth
CRZ25036      41 lddrTRIERKIEQIKERLSRISLAREADVDDFLSMTSSMeg----grENPQLARVRQHFEKKNKKSSQEIEHLKKKLEQL 116 Brugia malayi
Q18025        21 ereKAKIVQKLIEIKDKLRALNEKREADVEKFLSITRQSeisrgvgaDNPQRARIRNNFERQNRKHAHETEMLQKKLIDY 100 Caenorhabditis ...
EKC40365     112 KAAIEHYQRKLNKTMELIKAEQAAKEENVNEYLRLAASAs------eDKQQLARIKAVFEKKNQKSTQSISTLQKKLEGY 185 Pacific oyster
XP_009019798  88 RSAIEQLQVKIGKTQQRIKLEQNAKEDNVNEYLKLSTDA--------DKQQLQRIKAVFEKKNIKSAQAIAHLQKKLEEY 159 Helobdella robusta
EEB11565     149 SAAIEHIQSKISKTMDQIRAEQTTRDDNVNEFIKLATNA--------DKQQIQRIKSVFEKKNQKSAQIISQLQKKLETY 220 human body louse
XP_001949074 121 RAAMDHVRSKIVRTKDLIRSEQTARDDNVNEYLKLASNA--------DKQQLARIKSIFEKKNQKSAVGISQLQKKLEGY 192 pea aphid
XP_008205286 159 RQAIEHIQNKIAKTRELIKTEQTTRDENVNEYLKLAANA--------DKQQRTRIKTVFEKKNQKSSHNILLLQKKLDSY 230 jewel wasp
XP_007667852     --------------------------------------------------------------------------------     platypus
XP_015782805 122 LKR---IRDIEny-----gIQALHq-------hSRSKAMLTNVGHGLKGVGtni--kegISGLSE--------------- 169 two-spotted spi...
XP_014347179 311 HHKvmeLKELElklranpeQESKG---------RSPR--LSNVTR--------------ESSLSMiqsmqsvaprkpatw 365 coelacanth
CRZ25036     117 QSK---LVDLNmgivsevsPKSSVln-----niRKTGPLLR--------------------------------------- 149 Brugia malayi
Q18025       101 EER---LKLVDsg----eyEPSPTksrvfptgiRKAKGMTE--------------------------------------- 134 Caenorhabditis ...
EKC40365     186 SKR---IEEIQ--------TSGVTs-------hKKAKEVLSDMGHGLKGVGani--vdgITGFSGgvvgni--------- 236 Pacific oyster
XP_009019798 160 DRK---LREISl-------QGTTAi-------hKGSKGVLKDVGQGLRVLFvrdptrsrDASPSTs-------------- 208 Helobdella robusta
EEB11565     221 NKR---IRDIEs-------QKLHTs-------hRQPREVLRDMGQGLKNVGgni--rdgISGLSG--------------- 266 human body louse
XP_001949074 193 NKR---LKDLEt-------HGLTTsh-----hlKQPKEMLRDVGHGLRHVGgni--rdgISGLSG--------------- 240 pea aphid
XP_008205286 231 TKK---LRNYEm-------NGAQMa-------hRQPREVLRDMGQGLKNVGgni--rdgITGFSG--------------- 276 jewel wasp
XP_007667852     --------------------------------------------------------------------------------     platypus
XP_015782805 170 --------------GVIGSIKSFSspntHhssgdnfnskpkdSF--KNKIGSADNINSADnsindsstmnesesneGKEA 233 two-spotted spi...
XP_014347179 366 prngrvsssepvedTMSLRPPDFA------------------MGtlKTTVPAADSRDMAG-------------------- 407 coelacanth
CRZ25036     150 --------------EVIAAPRGIA----H-------------II--KSTFGSADNIPDSI-------------------- 176 Brugia malayi
Q18025       135 --------------TMVNAPIEFA----Q-------------RV--KSAF-SADNVNSTQ-------------------- 160 Caenorhabditis ...
EKC40365     237 ---------kgakdTMMAKPKEFA----H-------------LI--KNKFGSADNINQIK-----------------SLE 271 Pacific oyster
XP_009019798 209 --------------TMQLKSRNAAtlpgvwk-----tkdshhAF--KNRYGSADNITSSLi---------------PTQS 252 Helobdella robusta
EEB11565     267 --------------TVMSKPREFA----H-------------LL--KNKFGSADNINSLSr---------------NGEN 298 human body louse
XP_001949074 241 --------------SVMSKPREFA----H-------------LI--RNKFGSADNINSISrss----------eadLTED 277 pea aphid
XP_008205286 277 --------------SVMSKPREFAhltrH-------------LI--KNKFGSADNINSISrnng--------dsgsVEDE 319 jewel wasp
XP_007667852   1 -------------------------mkspspglppddpslvprssrtktpsirhhsanaevnrilqdsikhrilylseql 55  platypus
XP_015782805 234 QSkssgvHNQGGSVFYTHSHTHSHSTK---------------------HTSDESSSISSvsd------------------ 274 two-spotted spi...
XP_014347179 408 -------------------------------------------------TSPDEAASSRv-------------------- 418 coelacanth
CRZ25036     177 ---------ASGASNVGHSTFYSDTQT------------------------NDRIHKLDfenrdvapspakrghkrnetl 223 Brugia malayi
Q18025       161 -------NGTTGAPKTGQSTFFTTRKSadtdev----------esnavHKNRGAKRNSStlppnlsltspdplsaykeed 223 Caenorhabditis ...
EKC40365     272 EAggtegDKQHGGTLPASFk----------------------------YPSEDDNS------------------------ 299 Pacific oyster
XP_009019798 253 SVnpsnpNNLQSSSSANNSPIVNLTSQqqrlqlqq-----rlqqqqhqQLQDDSLNDEQq-------------------- 307 Helobdella robusta
EEB11565     299 GStgeedKTHHGSATLPGNCTLTTTTTttattvttq---gstpgntkkFASDEGSPCSSvtse----------------- 358 human body louse
XP_001949074 278 NSdkqsgRNHHGSATLPGGVGLHASTAgaa----------------asRSEDGASECSSvtse----------------- 324 pea aphid
XP_008205286 320 SGnk----aHHGSATLPGGCSLGSNHSagetgaatgaaggtsgqagikFPSEEGSECSSvtse----------------- 378 jewel wasp
XP_007667852  56 kvekssrdenmvgylklvskadrhqaplirqafekvnqrssatigqierklqqnyrqlqelelavrprsstlnadasspe 135 platypus
XP_015782805 275 ------niGAIAGLVTSGASSASpakqlyrtfdsqlvsQSGSSHNIHDLETILSQLRDREGDC-------QRLAEEIEAV 341 two-spotted spi...
XP_014347179 419 -------------------------------------eLIAEHLNPNTYTSILQQLADLKEEQ-------VNLEASFEKL 454 coelacanth
CRZ25036     224 psmafdldNLVISSLPEMLPHDE---------------PEVKFTAANTVIELHNDIQELKAQN-------QALFEQLNKL 281 Brugia malayi
Q18025       224 ssdpesrpGSAADETSNVPYHTAdnslylp--pnhpyhSAHAAPSEEGFNAIHEHLNSILQHL-------MLIDRKYDRL 294 Caenorhabditis ...
EKC40365     300 --------SILSGSNFEIQSSPLsnsq--------ntsQQFPGLTQAALEPILQEMEQIKESNkllsetvTRLTEELDQC 363 Pacific oyster
XP_009019798 308 -------------------------------------qQQLAIMQAKDLATIITNLTEFQEMQ-------YKLHCSVSTL 343 Helobdella robusta
EEB11565     359 ----slhlGQVTHHHTSPRHNRTsy----------------------nLDPLFRELQERREEI-------EILKEKLENL 405 human body louse
XP_001949074 325 ------sipPRTGPGAPPPPASAtt----------------------sLEPVWAEL--------------DHLRSKMEHI 362 pea aphid
XP_008205286 379 -----sgpGSRGQAHACGHEGGRpc----------------------sLKSIFAELQDHRENM-------DRLREKLDAF 424 jewel wasp
XP_007667852 136 teqptervlrceypepeetgpppanvtcpsleddfsgsqqdqtsksgslnrqddlavqkmndqldvvkmfyssletdfqn 215 platypus
XP_015782805 342 KTSLHAEYSLINQSLQEERYKSERL-EEQMNDLIELHQNEIENLKQNIGDMEEKVQYQSEERLRDIYEMLESCQTRISRM 420 two-spotted spi...
XP_014347179 455 RENYQHENKFLMNSIQEEKHKYRDL-EAQVNDLMDIQQTELMNIKQDLSSMEEKLVYQSYDRARDLWEVIESFQTRIGKL 533 coelacanth
CRZ25036     282 QTQNKSEFNYFNSALHEERIKTQRL-EEMLNETIELHQAEMIALKSDLNTIATRMDYQYSDRFRSIEENIESTQNKMIRM 360 Brugia malayi
Q18025       295 EDDIKKEIKFYAEALEEERFKTTKL-EEILNEAVELQQAEIATLKEQ-NLMATRVDYQHNDRFRNVEENMESLQNHLVRI 372 Caenorhabditis ...
EKC40365     364 KRWYSTELAALKQVFDEERFKYERL-EEQMNDMTELNQNEFSNLRQDITSMDEKIQYRLDERTTDLQDNVENCQTRITKM 442 Pacific oyster
XP_009019798 344 KTQLDEEGIFCRQALEEEHDRCERL-EEQINDLTELHQNEMYNIKQEMVGMQEKMEYQLEERTRDIQELLLTCQTRINKM 422 Helobdella robusta
EEB11565     406 KG-VHQEIQYLTMAIQEEKFRSERL-EEQINDLTELHQNEVENLKQALTDMEEKVQYQSEERIRDLHEMLENCQTKISKM 483 human body louse
XP_001949074 363 KQLVSKDIASLNHSLQEERFRTERL-EEQINDLTELHQNEVENLKQTITDMEEKVQYQSEERLRDIHEMLEACQTKMSKM 441 pea aphid
XP_008205286 425 KN-VQQEVSYLSHALQEERFRSERL-EEQINDLTELHQNEVENLKQTITDMEEKVQYQSEDRMRDIHEMLESCQTKIWKM 502 jewel wasp
XP_007667852 216 lkekylseleqiveclqeekcrRRLmEEQVNDHMQVHLDEILRLKQDLASTEEKMVYQSYEKAKEIWEVMETFQTRISKL 295 platypus
XP_015782805 421 EHQQHQHlQqLVNLDSLENSNA--RALVLKLINVLLTILQVVLLLVATVANIVTPFLKT----------RIRFLTTIFIL 488 two-spotted spi...
XP_014347179 534 ELQQQ-----AAQLEVLENPST--RAFFAKFMSLVLASITVILVFVSAMTSITIPLVKT----------RLRTLTTIFLL 596 coelacanth
CRZ25036     361 EVNVKEW------TESRPQTTF--NSVMLSGTNILVEFIKLVLLIVSFALDFVKPFTGT----------RTRAGFVIFFW 422 Brugia malayi
Q18025       373 ENALMDVrQvKLTSNVW-------QRVALNAGNIVVELLKIALFVVASILDLVRPLTGS----------RNRSAMAFGLV 435 Caenorhabditis ...
EKC40365     443 ELQQQQQ-Q-IISMEMVDNVTF--RTLLTKLINVVLAIVAVVLVVVSTAANLVAPFLTT----------RARILSSALLV 508 Pacific oyster
XP_009019798 423 ELQQQQ--QqLISMEGIENTSF--RGLATKLINIVLAVLAVVLVLVSEVANLIGPFLQT----------RLRIVGTALLA 488 Helobdella robusta
EEB11565     484 EHQQAQH-QqYVTLEGIDNSNA--RAVVVKLINVLLTVLQVVLLLVATAAGILMPFLKT----------RLRILSTLVLI 550 human body louse
XP_001949074 442 EHQQAQH-QqYVTLEGLDNSNA--RALVVKLINVLLTVLQVVLLLVATFAGILMPFLRT----------RLRIITTTAVV 508 pea aphid
XP_008205286 503 EHQQQQH-QqYVTLEGLDNSNA--RALVVKLINVVLTVLQVILLLVATGAGIMMPFLRTsctkphcfmcRVRILTTTFVV 579 jewel wasp
XP_007667852 296 EALQQ-----TAQPEMVEKCKTqaQVFLDKFMNLLVTLTNILLVCITSMSCCPLSLIRS----------PPRILATLMVI 360 platypus
XP_015782805 489 VIVMMFVRQK 498 two-spotted spider mite
XP_014347179 597 LLGTSYWWHq 606 coelacanth
CRZ25036     423 LALMILThfi 432 Brugia malayi
Q18025       436 FLAIFFGHHL 445 Caenorhabditis elegans
EKC40365     509 VAIILVGRNW 518 Pacific oyster
XP_009019798 489 SLLAILWNRR 498 Helobdella robusta
EEB11565     551 AATVFVLKQW 560 human body louse
XP_001949074 509 AGLFIAVKQW 518 pea aphid
XP_008205286 580 LGIVFVLKQW 589 jewel wasp
XP_007667852 361 ILGAVAWQNW 370 platypus
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap