Conserved Protein Domain Family
Strumpellin

?
pfam10266: Strumpellin 
Hereditary spastic paraplegia protein strumpellin
This is a family of proteins conserved from plants to humans, in which two closely situated point mutations in the human protein lead to the condition of hereditary spastic paraplegia. Strumpellin contains one known domain called a spectrin repeat that consists of three alpha-helices of a characteristic length wrapped in a left-handed coiled coil. The spectrin proteins have multiple copies of this repeat, which can then form multimers in the cell. Spectrin associates with the cell membrane via spectrin repeats in the ankyrin protein. The spectrin repeat is a structural platform for cytoskeletal protein assemblies.
Statistics
?
PSSM-Id: 402056
View PSSM: pfam10266
Aligned: 34 rows
Threshold Bit Score: 1086.08
Threshold Setting Gi: 393911464
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
XP_003721974                    38 STIVATLQRLAAHIPAEFt---APSRTPYARLIFDFRYFKHQDQIET--NIADSAELLVMDKEFYDTHMGLLEKFMALFR 112  Leishmania major strain Friedlin...
Q386S7                          30 SAIIVELLRLSQHIPREFv---HPEESEYAAIISDFSYFKATEAFEE--NISKSEVLLQRDEVFGNTHVEFLDRCFKLFR 104  Trypanosoma brucei...
XP_001418393                    54 qALAAELLRLGENAPRAL----SREDSKFARVLFDYEYFDARERAED--AAARDGSTYELDEEVRGSYGHVFERYWNAFD 127  Ostreococcus lucimarinus CCE9901...
XP_006844422                    30 QTLISELLLLSGRVPHEF------GDSRFDSVLFDLRYLDSPDDFEE--KIESNSHLAALDDQLRETCSVFLQRFLLLMN 101  Amborella trichopoda...
EFJ34129                       165 QALIAELLRLSDRVPEEF----KSPGSIFAPLLFDFRYFKSPDVFEE--RIESNAELSSLDDEFRDKYSYLLERFFQLFN 238  Selaginella moellendorffii...
EAY01964                        22 SSIIAEIQRLSQYIPEDFtfpkNQLNHPYAKIIYDFSYFGHETEIEN--LIESDPDLNELNEECRETHIEIVTRFCRLFE 99   Trichomonas vaginalis G3...
WGS:AAFB:cds.EHI_045500A        22 NTICSELFRVKDLIPEDF----INPSNCCKDLIFDYSYIPKSESIDM--KINSSRELRIIDMKIKEKYERIIWRTFQVFE 95   Entamoeba histolytica HM-1:IMSS...
EED92001                        20 hSILADIKILSEREPSQD----TDDVKKYVPFLFDFSYLHNPQEWEAtpAAESSESLLELEREFAVNHRKAIEEFYELFY 95   Thalassiosira pseudonana CCMP1335...
WGS:AAGF:cds.TTHERM_00145500A   23 STILAEMQRLSENIPKVFy--eNSQTSRYKNILFDFDYFKNIDTYED--VIQKNPDLVDLDELFKSNYMELLQRFYILFE 98   Tetrahymena thermophila SB210...
A0DY11                          22 SAILAEIQRLSENIPKIIts-kAQEYKKYEKILFDFEYLKNIDVLED--EIQRNQEINELDENFKKSYLPLVERFYRLFE 98   Paramecium tetraurelia...
XP_003721974                   113 GIYGYATELNRYVREIQDGQYVAQTLDTVLESLDGRQLLCELYHLYGVMLLLMDHKIGGLVRERIIVSYVRYRGSGe--A 190  Leishmania major strain Friedlin...
Q386S7                         105 GVFGYVVELNRFVEEILDGMYVSHTIESILADIDGKQILCEIYHLYGVMLLLLDHRFGGKIREYILVSYIRYKGTSe--P 182  Trypanosoma brucei...
XP_001418393                   128 AVVRWHQDFVRFAEDVAEGTYVSETWEKILSDEDGRQYVCEAIAMFGVILKILDAKFDWRFRERMVVAYYRMRGASediA 207  Ostreococcus lucimarinus CCE9901...
XP_006844422                   102 GIALYYRDLVKYLNDLQEGVYVQSTLDSVLEMQRCRQLLSESLVLFGVLLLLLEHRMGGTLREKLLVAFMRLDGSFg-tS 180  Amborella trichopoda...
EFJ34129                       239 GIVNYYVDLTRYLEDLQEGVYIQSTVESVLHNEDGCQLLVEALVLLGVVLILLEHRLDGTLRENLLVSYFRCKGTFd-vP 317  Selaginella moellendorffii...
EAY01964                       100 SIVRYALDFLHYLEQLNQHVFLQITVESLLNETQGKQLLGEALYYYGVMLLQMDYYIPGLVRERLLVTFNRWRGSSm-lL 178  Trichomonas vaginalis G3...
WGS:AAFB:cds.EHI_045500A        96 SIYQYTKQVEEFYDKIIEGEYLQYNAETLLVDVEGKQLVCETLSFVVRLLLLLDILIPGIVRERILIFVLRHKRSNe-fG 174  Entamoeba histolytica HM-1:IMSS...
EED92001                        96 SIYDYQVALNQFSSDLTKGFFIQYTVESVLLDLEGRALLCEAVWLYGVMLMLMERLLPGPVRERLIIAYFRFCGRDgdiS 175  Thalassiosira pseudonana CCMP1335...
WGS:AAGF:cds.TTHERM_00145500A   99 SIYLYHKDLNVFIEQVQEAIYIQYSFEVILQDPEGKKLITEAFYLFGCMLLLMERLIIGPVRERIVIAFYRYSGGQsaqE 178  Tetrahymena thermophila SB210...
A0DY11                          99 SIYLYYSDLMAFIQELEEAVFMQYSVETVLQDPEGKRLFAESFYLYGCMLLLVDILIPGKAREKLIISYYRYKGGQtaiE 178  Paramecium tetraurelia...
XP_003721974                   191 HTVEVAELCRATSQGAdggaaiagssveRtpvspraaagsgTGISNYP---------IDYFERVPVQKGVVARLLACIRS 261  Leishmania major strain Friedlin...
Q386S7                         183 NMMDVTSLCRTTGYRCds---------------------anGLPPNYP---------LSYFNRVPVDKKVVGTIIGRIRS 232  Trypanosoma brucei...
XP_001418393                   208 NADEIVTLCARTGYDAar----------------------kTRPEGYP---------ELYFARFEMPEWLIYMVIGRLRT 256  Ostreococcus lucimarinus CCE9901...
XP_006844422                   181 NLDLIRLLCRAYAPGPgssfpsstafipSqcvllk-ssfgsMISVQKP---------EDLFARFPFPKTVVDSIVSCLLH 250  Amborella trichopoda...
EFJ34129                       318 NFDSISTLCRHYPQPTsspvva-------------vtaflqSSPPPVPatmlnlhrpEESFSRFPLPSSLVKTVIGRLKS 384  Selaginella moellendorffii...
EAY01964                       179 NYSKVCEVCRQSGYVVg-----------------------qPYPMGYP---------LEFVNRLEIPVDFVNVLIGKYRN 226  Trichomonas vaginalis G3...
WGS:AAFB:cds.EHI_045500A       175 DLDKIIPLVKRTEYIVgs----------------------sKKPSNYP---------DEYLKRIHVNDYIVQMAIGRMLS 223  Entamoeba histolytica HM-1:IMSS...
EED92001                       176 QIDTICKLCKSTGIQPpkstds--------------vnmseQLSHKYPmd------eDKLFNRYPLPVDLVRNIVGCLIS 235  Thalassiosira pseudonana CCMP1335...
WGS:AAGF:cds.TTHERM_00145500A  179 NINQVIKLTANTGYLPaiyn-----------------ngeeKRPLEYP---------DFLFDRFPFKNELIDQILYQIKE 232  Tetrahymena thermophila SB210...
A0DY11                         179 FINEVTKLCAETGYSKs-----------------------gTRPAFYP---------EEYMARFQLPEKLITEVINSIKD 226  Paramecium tetraurelia...
XP_003721974                   262 DDIYRMSSHYPNPDHRSAAMALQGGIAFVLLFFCGDVLAQQLPVMKELVEKHFADNWVVHYYGGYTADLSVAWAAFPAAR 341  Leishmania major strain Friedlin...
Q386S7                         233 DDIYQMSYNFPVPEHRSAALSLQGAVLYVLLFFKPEILQHEGPVMREIVDKHFADNWIINYYMGFTVDLMVAWREFPAAR 312  Trypanosoma brucei...
XP_001418393                   257 DDVYNHAPHYPNPDHRSTALAAQGGLLYIILYWAPKILNRGTSAMREIVDRHYADNWVVAYGAGLTVDLLTEWEPYEAAS 336  Ostreococcus lucimarinus CCE9901...
XP_006844422                   251 DDLYSQICHYPDPEHRTVALATQAGYLYILLCYSPHFLH-DAFVMREIVDRLFKDSWVVPIFMYFTIDLSLSWEKYKVAR 329  Amborella trichopoda...
EFJ34129                       385 HDLYNQVGHYPSPDHRTTALLGQAASLYVLLYFAPTILHSDSVMMREIVDKFFRVYWVL-----------------STAK 447  Selaginella moellendorffii...
EAY01964                       227 DDCYLMLQNYPEAEHRSVALAQQASMLFIFLFFSPNTLNNENFIMREIVDKFFFDNWIIPYFMGDVVDLSVIWKDFKAAN 306  Trichomonas vaginalis G3...
WGS:AAFB:cds.EHI_045500A       224 DDIYNTTKSFPLPDHRSSALSAQGSLLTMILFLSPQTLNNNISFMNEVVNKFFGDCWIVPIYIGHCIDLTFFWDSYKSAR 303  Entamoeba histolytica HM-1:IMSS...
EED92001                       236 DDIYQQSSAFPNIDHRSTRLSRQASMLYVIMYFDPIVLRDETSKLREIVDKYFLDTWVIHIYAGLTADLSLEWDKFPAAK 315  Thalassiosira pseudonana CCMP1335...
WGS:AAGF:cds.TTHERM_00145500A  233 QDIYKHKTAYPDKDHRSFAYAAQASMAYVLLYFVHDTLNSKKQLMREIVDKHFYDNWVIAFYLGYTVDLTSEWARYNAAK 312  Tetrahymena thermophila SB210...
A0DY11                         227 EDIYKYTSIYPSADHRSIALSVQGSMLYVLLYFTPTILNNKKAKMREIVDKHFYDQWVISFYLGYFVDLSEQWNPYGAAR 306  Paramecium tetraurelia...
XP_003721974                   342 AALRRTLESHSVTYHLQRMRGALARSTERVQAVLEEGMLTENYVLDNVhASLLPIITESNVVLRWFVLQGVCSASASSPp 421  Leishmania major strain Friedlin...
Q386S7                         313 NAISGTVTLENIGYYMTRQRQSMSSVYDSIEEVLRQGVLTEQYVLDNIhSTLLPLIREANVVLRWFVLHTHRLDGRNFY- 391  Trypanosoma brucei...
XP_001418393                   337 TAMRNAVTPKAARELIDNASTRVGELKTAFKTYLTEGVLTEEFVLSNE-KVLMNVVRDANVVARFVLLHNL--------- 406  Ostreococcus lucimarinus CCE9901...
XP_006844422                   330 SSLSFCLSPANVRDICQMHYAKVKDLSSKITSAKSDITHSVDYVLSNS-QTLLSLVRNCNVSLRWLFLHRS--------- 399  Amborella trichopoda...
EFJ34129                       448 NAISSSITLSAVRVVSQEQISKVQTLLSDLSAFLSEGVLNQDFVLNNI-STLLSCARDCNATLRWLLLHKI--------- 517  Selaginella moellendorffii...
EAY01964                       307 IAIQNTMKQ-NSMRYAQRYMELYEPIHTKIKQVLSDGFTKTEQLLDGI-NDFFKLDRDANVCIRFLLLHTQ--------- 375  Trichomonas vaginalis G3...
WGS:AAFB:cds.EHI_045500A       304 QALQRVVTPSHIENIWKGHQQVMAKCKVELQGYLEEGGMTDEKVMLNM-QKLINCQRNCNVVLRWALLHGT--------- 373  Entamoeba histolytica HM-1:IMSS...
EED92001                       316 SALDNVLREDNVKRMHIGNAKLIGQCMAELRAYLTMGILTDRFVLDNR-HDLLNCLRRCNIAAKWRILHRR--------- 385  Thalassiosira pseudonana CCMP1335...
WGS:AAGF:cds.TTHERM_00145500A  313 EALGFIFDLEYIPQLVKYFQENLSKAYLKCKEYLNDGVLNEEYVLDKI-QNLLSCLRECNITVRWLMLHKNTTN------ 385  Tetrahymena thermophila SB210...
A0DY11                         307 EAIKNTINFDYIQELGTFYRNKLTEQINKVQEYLYEGQMTQEFVLDKI-SSLMNCVRESNIAIRWILLHSNTSI------ 379  Paramecium tetraurelia...
XP_003721974                   422 aspvcgdpdeaslRAAASAAGQAVRASF-----ENDELLTLLLATAQLERDVYSRFAVVLQEKTARWAGARRQAVSRVQK 496  Leishmania major strain Friedlin...
Q386S7                         392 -------------HEKSRQIYEMIAGCV-----RDDDIIMLLLRTAQLEFTLRAMFANLLKQKRARWESSRQEGAMKMAK 453  Trypanosoma brucei...
XP_001418393                   407 --------------TTHKSVSSLVSYMP-----SKENIIDLLLDCAELENELKKIYTSLLSGKHELWEKCKHEAGERMKE 467  Ostreococcus lucimarinus CCE9901...
XP_006844422                   400 --------------TSNKKLRDIVISVGdaqqiGEDAMIILFLETSKVEFEVKKLYSELLGGKDSQWKQSKNKAAHNMLQ 465  Amborella trichopoda...
EFJ34129                       518 --------------TTSRKLRELVSN-------QDMALLTLLLDTSRLEFELKNVYGELLKKKESRWAESKTIVAECMND 576  Selaginella moellendorffii...
EAY01964                       376 --------------EPGKKVQFPF---------SRDKLLAFLLDLGEFEFELKNAIETALNTKPEIWTDTRNNAVSILKQ 432  Trichomonas vaginalis G3...
WGS:AAFB:cds.EHI_045500A       374 --------------YPIKKLRDIFVKPK-----YHEDIIDFLLETAQFEFELKRIIGNIVKEKPLQWENLKNESSKRMKD 434  Entamoeba histolytica HM-1:IMSS...
EED92001                       386 --------------TSNPIFYDIVCFAV-----NDTHLVSLLLLSSQLEMQLKDIFQQLLEKKENIWISCRSKAGKMMDD 446  Thalassiosira pseudonana CCMP1335...
WGS:AAGF:cds.TTHERM_00145500A  386 --------------KKAKAICDKI---------SQKDILQLLLLSSKFEEKLKTSLKNLIDTKVPRWDQDKKRCCKRMEE 442  Tetrahymena thermophila SB210...
A0DY11                         380 --------------PKAKELLNKI---------DKQEVLQLLLQSSKFENRLLKAIKAIIDNKQQYWDEDKVKCVERMQE 436  Paramecium tetraurelia...
XP_003721974                   497 LSHFFSEDNLLDTSVHDAELERWFAEVGARITNLHMKRQsakAT---RRKLQRLVAALENIQEFAQVNQQLQVLQYVRET 573  Leishmania major strain Friedlin...
Q386S7                         454 LSTFFSGKHVLSDDMCDPQLEAWFMEISQRIEGLEYANSt--IA---SRKIQKLIKALENVQEFHQVDSNLQVIQFVQDT 528  Trypanosoma brucei...
XP_001418393                   468 LSAYFGGTAGLSRNAKDENLRLWFANLSVEVERLSYDDAv--AA---GRTIQELETALTEVEQFHQIVDNIHAKQYLLDS 542  Ostreococcus lucimarinus CCE9901...
XP_006844422                   466 LSEYLSSSGNLSSEFKDESLKGWFGDLSSQINSLDYKTTt--NV---GQKLNHMIFALKEVGSFHQIEGDFQVKQHLCEI 540  Amborella trichopoda...
EFJ34129                       577 LSAFFSGVKVLSRTIRDENLQQWFSQMCSEVNSLDYSEAv--TA---GRKIQHIITALEEVEHFHQIQGSLQTKQYLSEA 651  Selaginella moellendorffii...
EAY01964                       433 LALSFSGTLSLASLQKDEKLQQWFENMAGEVNILEIDNSv--GN---VQKIYQLTTALESILPFHQISSSIFIKESVAKV 507  Trichomonas vaginalis G3...
WGS:AAFB:cds.EHI_045500A       435 LSNYFNDENKLSE-HSNSGLMKWCLFMSEQIDKLDv------KEissGKSLSKLIQAMEEVETNYLNDLSLVVVETVRKT 507  Entamoeba histolytica HM-1:IMSS...
EED92001                       447 LAHYFKGDQTLARVSRHDGLITWFTAMGEEIRALTYEDGd--HFtvtGRKIQLCVQALEEVEQYDSIDRDVQVKTFLVEA 524  Thalassiosira pseudonana CCMP1335...
WGS:AAGF:cds.TTHERM_00145500A  443 LTNYFGGSSTLQEIQANKSFEAWFTEMKNQIERLSFEDIt--YA---GRKIKQLTEALDDIEQYNVMSENIQIKQYLLDT 517  Tetrahymena thermophila SB210...
A0DY11                         437 LSDYFSG-KALGKVKADESYMQWFTEMGSQIQSLNYSDSt--HA---GRKIQRLIQALEDIEQYPQISTSIQVKHYLNET 510  Paramecium tetraurelia...
XP_003721974                   574 CADLHQMLHYLNAERRVLGRFATVTDFSYAWELLSaRgyLVRELQARIRRQPVVAAQMQALFAKLSSLLHLPCIRIDEGV 653  Leishmania major strain Friedlin...
Q386S7                         529 RFLLLQMIRYINIENKVLITIATVGDVSYAWESMAyYnnYVIAMQLKIKQKPDLAVQMRAVFMKLASLLELPCNRIDQGA 608  Trypanosoma brucei...
XP_001418393                   543 RGYLGKMMMTSNVADSALNTLTIVSDAAYAWRVLD-P--YTEQLQQRIRKDPFAVRKLRFTFLKLKSILEMPLLRISQME 619  Ostreococcus lucimarinus CCE9901...
XP_006844422                   541 QTYLQDMFKTLSLQKRTLDTISVISNSTYVWGFVG-S--FVEKLHKSIEKDSSTVLKLQPFFLKLHSMLEAPVFRLSQGN 617  Amborella trichopoda...
EFJ34129                       652 RMQLQEMIRTLNVQESTLATISVISDCSYSWGLIG-E--FTLLIQSQIQNDPFTVSKLQCLFLKLRSVMDIPLLRLYQSQ 728  Selaginella moellendorffii...
EAY01964                       508 IEALKILARLLNIDEKFVPLIGTLSDFSYGFSLVR-S--FIPLMQKRIKKDPFSVLKLRATFLKMTSILDLQLVRIIQSE 584  Trichomonas vaginalis G3...
WGS:AAFB:cds.EHI_045500A       508 KDMLTKMFRLLNVNDTVRGLLDNISDCSYANELLS-TqvYVEYLQQIIKKNPRNSLKLRSLILKMSSILHLALLRMMQAK 586  Entamoeba histolytica HM-1:IMSS...
EED92001                       525 RGLLLQMARAVGINEDICEDIRWISDMSYGIESVK-S--YVKIIHSRVTKDPSNVNLLQGFFMKLSSSLDAPVERLKQLN 601  Thalassiosira pseudonana CCMP1335...
WGS:AAGF:cds.TTHERM_00145500A  518 KKDLKRMVRIVNIQEEYLTHIDLISDITYSWQSLQgI--YVTNMQDKIKKNPQLSLLLKTTFMKLSSILNTPMVRIVQSE 595  Tetrahymena thermophila SB210...
A0DY11                         511 RKDLTHMVKIVHIKSTLPSHISYISDFSYSWQCLK-G--YKELMQAKVQSNPHSALSLKTTFQKLSSILNTPTIRIIQAG 587  Paramecium tetraurelia...
XP_003721974                   654 AvtaasalgVDvrleraLQFTSTFYSEEVVSFLRSVLQVIPTSIFEVLNKVMYLLTNALRECPSKLQRDEWKRWSQLETR 733  Leishmania major strain Friedlin...
Q386S7                         609 Q--------NDarllvaLESTSEYYSGELVAFARRVLHIIPTSIFSILRQVMDILTNHLHECPTKLARKEMKGQSQLNVR 680  Trypanosoma brucei...
XP_001418393                   620 S--------PD------IYSVSEYYSSQLVSYVRSVVEVVPISMFEILNEIIGVQTNALKELPTKLEKTALSDYAQPAER 685  Ostreococcus lucimarinus CCE9901...
XP_006844422                   618 S--------VD------LQFVSEYYSSELVAYICAILEIIPVTMFNILNDDFACNLQPLNF-QHRMEKDNLQNLLVIGTQ 682  Amborella trichopoda...
EFJ34129                       729 S--------AD------LDSVSEYYSSELINYVRNVLEIVPASMFTILNGVIKEQMMNLSEIPGRFEKDSLKDYAKLDER 794  Selaginella moellendorffii...
EAY01964                       585 S--------KD------VDSVSEHYSNIIVQFVRDVLEIVPISIFGVLDQIIQLRTNVLKELPNRIERAQLKQYAQLEER 650  Trichomonas vaginalis G3...
WGS:AAFB:cds.EHI_045500A       587 T--------DEq-----MENVSKYYSEVLVNYVQRVLEVIPEQVFLLINSIAKLQVTSIPETPVFVEKKDIISFALFDER 653  Entamoeba histolytica HM-1:IMSS...
EED92001                       602 S--------PD------ATRVTDYYSLQLVSFVRKVLEIVPISVFGLVVQMSDIIERRLLRLPKKVAADQLIAFSQTGER 667  Thalassiosira pseudonana CCMP1335...
WGS:AAGF:cds.TTHERM_00145500A  596 S--------DD------LVSVSKFYSGLLIKFVKNVLQIIPISVFDILQNIINLLTNSMKKLPPKLKKEELKEYLQPEDR 661  Tetrahymena thermophila SB210...
A0DY11                         588 S--------PD------LNSVTKYYSGELVKFVKEVLQIIPIQVFEVLQDIITLITSVLKPLPSRINKIELKDYAQYEDR 653  Paramecium tetraurelia...
XP_003721974                   734 EQLCACTADIARYAAGLLAMEETTVGVVRVNPHQLLEDGIRKELVEHITRELHAGIWFDRs-------K------PSTV- 799  Leishmania major strain Friedlin...
Q386S7                         681 KALSTHTADIVKYASGILAMESTLVGIIQVDPHQLLEDGIRKELLQQITMELHNSLLFDAk-------K------PPSA- 746  Trypanosoma brucei...
XP_001418393                   686 AQLSKATYEISIFAQGILAMERTFMGVIELDPKQLLEEGIRKQLVKQITETFHTALVFGDgakdalgwnnfvaamMKTN- 764  Ostreococcus lucimarinus CCE9901...
XP_006844422                   683 YQLAKAATRIATLSKGILCMSRTFQGIIDLDVAKWLEREIRKELSKRISNILNSFRLLPSv-------K------L---- 745  Amborella trichopoda...
EFJ34129                       795 YALAKATQRVAVFTQGIMSMKRTFIGAIELDPRQLLEEGIRRKLAEEIDLALKKALVFST---------------GRTE- 858  Selaginella moellendorffii...
EAY01964                       651 SKLAHLTKEISILTSGVLAMKTTLMGVITVDPKQMLEEGIRKQLVKKIIKVLYEQLVQPNt-------Ke-----QITA- 717  Trichomonas vaginalis G3...
WGS:AAFB:cds.EHI_045500A       654 NYLAELTHAVSIYAEGILAMETTFVGIIQVDPVKLLEDGIRKALGRRLKNMFSKTLQF------------------KIKg 715  Entamoeba histolytica HM-1:IMSS...
EED92001                       668 YKLAMMAHEISIFADGILAMENSFIGGKEVNPRKLLDDGLRKEMVQHVSELMNNLLQFDFs-------AdtetitSMTNh 740  Thalassiosira pseudonana CCMP1335...
WGS:AAGF:cds.TTHERM_00145500A  662 SKMADYTYKISLFTESILSMEKYLIGVIEINPKEILDDGIRKELIKCICKQLDQRLIFQSn-------Sd-----I---- 725  Tetrahymena thermophila SB210...
A0DY11                         654 TQIAKLTNSISVFTESILTVDPYLLGSIEVNPREMLDQGIRKELMALIHKILDSQLIFPK----------------KDI- 716  Paramecium tetraurelia...
XP_003721974                   800 ---EdLDKELVQLGARLRGVRNSFEYIQDFVNVHGLKIWMEEFQRIVRFTLQMECNAFWPKK-VYPWSSPYQSASIT--I 873  Leishmania major strain Friedlin...
Q386S7                         747 ---AsFNEGLARLAQKLNGIRASFEYIQDYVNVHGLRIWLEEFSRIVNFNVEMECNAFLQKK-LYPWESQYQSESIP--I 820  Trypanosoma brucei...
XP_001418393                   765 ---P-FEDRLNSLANRIEGFRRSFEYIQDYVNIYGLQVWQEETNRVVSYHVEQECNSFIKRKqVNDWESEFQSVAIP--I 838  Ostreococcus lucimarinus CCE9901...
XP_006844422                   746 ---QeLEENVRALMVSLHTQFQLLEILLGFVHVQGQHIWEEELTFILNHSLQQEYCKYVERR-KQDLCCMQEINNLS--N 819  Amborella trichopoda...
EFJ34129                       859 ---D-LEDKLEALSASLSSQRQSMEYFQDYAHVHGLKLWQEEYTNIVNHNTELGCKHFLTKV-HKQPTSILDSGSVN--- 930  Selaginella moellendorffii...
EAY01964                       718 ---ErFNKIIDRVGRAIDGIRHSFEYMGDYVNIDGLRIWHHEYSRIMCYLVEQESNKFVKKK-ILGWQSEYQSKVAPikI 793  Trichomonas vaginalis G3...
WGS:AAFB:cds.EHI_045500A       716 nlgE-TLTQLSELSNQIGGFSTSFRYIQDYLHIDGLKVWQEEFTNVISTCVNEECNSFLANGld---------------- 778  Entamoeba histolytica HM-1:IMSS...
EED92001                       741 --qSaAMRSLSSLSSRLEGFQSALECVEDYVCINSLKMWHGEMSRIINYNVEQEVNKYLLKK-VLDSDSKFQLRVIP--I 815  Thalassiosira pseudonana CCMP1335...
WGS:AAGF:cds.TTHERM_00145500A  726 ---TqFQTTLFNLAEHLSGFKRALEYIQDFIGNFGLKIFHEEFDRLILTYIDMEQIAFVTNK--LDYEELLYDDDIP--M 798  Tetrahymena thermophila SB210...
A0DY11                         717 ---QdFQTKLSKLGEEINGFKLAMEQIQDFVNAQGLKMFTEEFNRLIECYTSMELKGLITGN--KEYEELSYDEDIP--M 789  Paramecium tetraurelia...
XP_003721974                   874 PHFAPAnP-KDAYSFLGHLVQHLLYLTDPRESI-YFPAYGAWFTRRQLCECVGPRLFSRVADAVDCTGLACLDELLSSIA 951  Leishmania major strain Friedlin...
Q386S7                         821 PYFEPTpG-RSTYSFLGGISQHLIAITDPSHAL-FLKSYGAWFERNSLEEVVGSRTFASIGEAIGSMGLVALDRMLCFII 898  Trypanosoma brucei...
XP_001418393                   839 PDYPALd--GESKNFMGRLLRELMRQTDPKTTR-YVSPHSGWFDTE-GSEVVGIRTFSLLTSAVGNVGLAGLDRLLSFMV 914  Ostreococcus lucimarinus CCE9901...
XP_006844422                   820 PE-----------TFLGRLLHQILLLTHPSQSM-FLEPMSGWFDAG-GHELLGLHFFDLFESCVGPFGLSSLDCALYFLI 886  Amborella trichopoda...
EFJ34129                       931 -----------DDNFMNRVVLKLLNLTNPSKSM-YLAPMTGWFNAE-GQELVGLRTFITLQESLGPVGVSGIDSIVSSHA 997  Selaginella moellendorffii...
EAY01964                       794 PKME-----GKYATCIGSLAFSLIDLTRQTNSV-YCGITGGWLNPQTGEEVLGTKTIDRLCNAIGIEGTSSIDLLLSFTL 867  Trichomonas vaginalis G3...
WGS:AAFB:cds.EHI_045500A       779 --------tVNSQTFIGKLTSQIMSIVDYRKNVfYLSAANGWFYKD-GKEVIGYVFMRKLVSALSVLGVTGINQLCAFKC 849  Entamoeba histolytica HM-1:IMSS...
EED92001                       816 PRFARTpNePTCINFMGRILSMLLKITDTQYTT-YSLERIGWFLGD-GTEVCGLKNVSLLRKAIGIYGLTGVDRLLCYRI 893  Thalassiosira pseudonana CCMP1335...
WGS:AAGF:cds.TTHERM_00145500A  799 PDKSVMeK-QGSVNFMGRLLRELMRITDYRQCV-YVEQNLGFYHYSKGTEIISLKTMDLLYRCVGVGGLNGLDQLFSFMI 876  Tetrahymena thermophila SB210...
A0DY11                         790 PDDKSKq--YGAINFIGRLLNQIILITNPREVV-FVESTLGFYDSN-GKDILNLKTIGLILKCIGVSGLNGIDLLLSQHL 865  Paramecium tetraurelia...
XP_003721974                   952 TKDMQLLVqRLAESVASLESAQRGAVQEVWARCMpTSSTPEKDa-fLKDYDQLASILEAsAAAq---------------- 1014 Leishmania major strain Friedlin...
Q386S7                         899 AKNLQQLL-KTIRATL---EPLEETVMNLAEELCsSSHDPRKL---IEIYEKLMKLINSsGGEgsvpletkeynnrvvik 971  Trypanosoma brucei...
XP_001418393                   915 TQKLQMCIeSYSERL---RGDLGATIRALDNALRpLGSVPEGS---IEAYEQAIRASSS-AWD----------------- 970  Ostreococcus lucimarinus CCE9901...
XP_006844422                   887 VGHLEQAL-SGLRSLL--DTRFMEDFEALGNALGpATSIPLLG---LSSYDRIIKMTEK-SWE----------------- 942  Amborella trichopoda...
EFJ34129                       998 ARVLGKCI-SSFRSEI--EVKLLDHLQALEGAVRpLSVTPNGA-----VYAECIALIST-STEc---------------- 1052 Selaginella moellendorffii...
EAY01964                       868 ARQLRQFFeKF-------EKGHFGNYTNLLNKLLdMWPSPPES---MEVYNDLLTRIKQdSHD----------------- 920  Trichomonas vaginalis G3...
WGS:AAFB:cds.EHI_045500A       850 VKELNDII-TTVNLIVEKYSVFNQMTQNFNENKLnEQNI-------FKVIDNGLSVVTK-IGR----------------- 903  Entamoeba histolytica HM-1:IMSS...
EED92001                       894 LHELHRFV-KFFRNNVSKQGVL---FEQLRDELYpEWKTPHNV---VSIYASGSKKTEMlMLP----------------- 949  Thalassiosira pseudonana CCMP1335...
WGS:AAGF:cds.TTHERM_00145500A  877 ASQIKTVI-RQIKKEL--NTETKAELAELIQSIKdLNQFTEKFdkqIQSTKKIFKQISN--------------------- 932  Tetrahymena thermophila SB210...
A0DY11                         866 SKAVKDIV-RILKQEL--NQENRNIIDTLIKQVRlFTNYDENY---DKVYKQLAKQFRPlISK----------------- 922  Paramecium tetraurelia...
XP_003721974                  1015 ----EVGVVAMRLGRIALIRQLIAHQLRSDSKQDSSALVACTQAVNTAVVATLnSHLAKDPfearaagssrscadvSEGL 1090 Leishmania major strain Friedlin...
Q386S7                         972 dhlaEVTKLMVLVGRIQIMRVMIAHELRSFCKLNSGSLFAALSTVNEALLTDL-QHHYHSPdsh----------pmpGEI 1040 Trypanosoma brucei...
XP_001418393                   971 ----DMLAAFATIGQAQLLRRQLNAELVANIRIDSHTLSRALDTANKAILTDI-RSHYKSPdtvp-------ypdeANAI 1038 Ostreococcus lucimarinus CCE9901...
XP_006844422                   943 ----QWVVCLAYVGQLQLLRCVISSKLKSACKVNAGAVSFAVEQLVDSLF----HCNGKDVdherps---qekytdMESF 1011 Amborella trichopoda...
EFJ34129                      1053 ---vTWVESLAHIGQLQLIRCLLSSQLRAASQLESGMVSFALEGLGTALFSTMeTNSERTNg-------------kSNGV 1116 Selaginella moellendorffii...
EAY01964                       921 -----WTILICSIGQLQLLKMTIDAHMELKCKLEAESLNFMLENTNTTVLQAI-KQFYRDPthn---------pypSSNL 985  Trichomonas vaginalis G3...
WGS:AAFB:cds.EHI_045500A       904 ----SLIDTLHNLGTLQLLREQLNCQLCSENRTKATSLHFALKSFDQALVHDFf----ENPnkk----------erEPLI 965  Entamoeba histolytica HM-1:IMSS...
EED92001                       950 -----MLTCFRRVGQAQLLRRMIRFELQRCARVDAKELQHSVSTLNASLL----STQQRDGp-------------eETKM 1007 Thalassiosira pseudonana CCMP1335...
WGS:AAGF:cds.TTHERM_00145500A  933 ----AIQDKILKIGQMVLLRRLICLQLQIKAKVGSNRLFLSLETLNDSIINDIlNRPTTEAmntve------aqekQNEL 1002 Tetrahymena thermophila SB210...
A0DY11                         923 -----ILYPLQQIGQYINLRKLICLVLQMKAKVGSTKLFLCLETLNNTIINDFiNRQYDSTmesdv------ktqmENNL 991  Paramecium tetraurelia...
XP_003721974                  1091 VCGMAPLLSSVGLTDPFATVYEVADgggggspsgddtagefsfgapppapatagsgaarpvavptklP-LPLLVLPLCVV 1169 Leishmania major strain Friedlin...
Q386S7                        1041 INAVSPFLDCAGISDALTKVYVTSK------------------------------------------P-IPSFVFYLIAL 1077 Trypanosoma brucei...
XP_001418393                  1039 VPKLSAYLSASGMQNPLRQIYCTVA------------------------------------------AvDDDWGLAAFVF 1076 Ostreococcus lucimarinus CCE9901...
XP_006844422                  1012 LHQMNKQRMLCGSLSPLRIQYIAGS------------------------------------------P-PSQIGRFASIV 1048 Amborella trichopoda...
EFJ34129                      1117 LKELARQLQACGMFSPMKTTYITAK------------------------------------------P-PAHISLFLFLI 1153 Selaginella moellendorffii...
EAY01964                       986 IAAISTYLENCGMCRPLEKIYTMSK------------------------------------------P-LPEISLVIFSL 1022 Trichomonas vaginalis G3...
WGS:AAFB:cds.EHI_045500A       966 YNEINRFLDVAGFVPALSKVYITCA------------------------------------------EgGDQIASVLSSF 1003 Entamoeba histolytica HM-1:IMSS...
EED92001                      1008 ICDFTT---AVGLGNPLDTVFMATN------------------------------------------P-LEGLPVLLLFF 1041 Thalassiosira pseudonana CCMP1335...
WGS:AAGF:cds.TTHERM_00145500A 1003 LFDTTKLFSYVGISDPIKKVYLTTE------------------------------------------P-IEGLSLMMLGL 1039 Tetrahymena thermophila SB210...
A0DY11                         992 LFDLTKLFNYVGLSDPIRKIYALCE------------------------------------------M-PEHTPLILALV 1028 Paramecium tetraurelia...
XP_003721974                  1170 VLLHV--QKCTYSARFDSCIPAEk-ED-DVDPTVLAVGVAILLQQFPLEATRLLLQLLAQVV 1227 Leishmania maj...
Q386S7                        1078 TLRNI--PRMRYDDKLASMVPSEl-KY-LLDPEALVIALALLLKQFHSDQLVLFLNHLSRVV 1135 Trypanosoma br...
XP_001418393                  1077 TLTQL--ELYRFDDVASTLVPINqsVT-KLDAHVLILAVSTTLRQFHADQTTSYLSHLGAFa 1135 Ostreococcus l...
XP_006844422                  1049 TISQL--SRYVLDIHLGALTCRTk-KL-VLDFCPLIIGLGTFLRQ-NDSSLRDYVKYMGQYV 1105 Amborella tric...
EFJ34129                      1154 TINQL--TRFVLDKHLGTLVSKAk-KT-ALDCCPLVAGFATLLHQFHPSHSILYIQartphy 1211 Selaginella mo...
EAY01964                      1023 TLLNLnnQKLQEYDRLHMLHRPNi-YA-HFE---FIVGIITILRQLNVNHQYAYLTFIGQYa 1079 Trichomonas va...
WGS:AAFB:cds.EHI_045500A      1004 ILYCS--QFFIFDSKYQTLMLRPkaPV-PYDPYVLAVGIVTVFRQFHPSTMWASFSYLSLYV 1062 Entamoeba hist...
EED92001                      1042 VITYV--PKLSYDSNYGSLAKVKg-GY-PIDGCPIVAGTASLLKQFHPSYTKSFLAYVGQFI 1099 Thalassiosira ...
WGS:AAGF:cds.TTHERM_00145500A 1040 VLNNI--NLMDYSYQLKSLIAKKseRI-NLEPNYLLNGIIVFMNQFHPSVQEIFTGLIG-YF 1097 Tetrahymena th...
A0DY11                        1029 ILHQL--PLMDFDKKLNCLVKKAkdNQlQFEPNCLLMGIVGFLNQFNQLHSSLFVSYLGFYI 1088 Paramecium tet...
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap