Conserved Protein Domain Family
Stork_head

?
pfam10264: Stork_head 
Winged helix Storkhead-box1 domain
This is the conserved N-terminal winged helix domain of Storkhead-box1 protein which is likely to be a DNA binding domain. In humans the full-length protein controls polyploidization of extravillus trophoblast and is implicated in pre-eclampsia.
Statistics
?
PSSM-Id: 402054
View PSSM: pfam10264
Aligned: 16 rows
Threshold Bit Score: 122.01
Threshold Setting Gi: 3877447
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
XP_015793117  237 MSLVCQAKFTPLTEALCKCINDFNNRSTHVFLGDIAEAIKQSYPNIIPPTADMIKKTLRSLQRAGKVrFSTSEGYFLVKP 316  two-spotted s...
EDX11326      118 VTPTVQGQFTPLPEALCDVIMDLTAEGQSATIEHVRSKLGSRFPHMTTPATEVIYDSLAQLMQEQKI-YQTSKGYFIFTP 196  Drosophila si...
Q7Q578        118 VTPIVQTQFTPLTEALCDVIMELTSQGQSATIENIRNRLRSRFTHMQQPSVEVIYDTLVQLMQEIKI-YQTSKGYFIVTP 196  Anopheles gam...
XP_002432938   21 vSLINQGQFTPLPEALCWVILELTSSGQHAVLESIRNCLHLSFPDIEKPSSQVVYDTLAKLMSDKKI-YQTSQGYFIITP 99   human body louse
XP_016660151  131 vEDLNQGQFTPLSEALCLVILELTSANQNATIDTVRSALKIFFSNIQPPAEHIIYDAMVNLMSDNKI-YQTSRGYFVVTP 209  pea aphid
EFN75110        8 VAPVSQGQFTPLPEALCWAILELTSQRQAATLDTLRSALRNAFPAMQRPSRELVYDALAKLMQERKI-YHTSQGYFVVTP 86   Jerdon's jump...
EFX83794       72 VQPISQSQFTPLPEALCWVIWELNLAERSTALDDVTAALGNAFPDLVPPSNKVVYDTLGKLIRDRKI-FYNGKGYGVVTP 150  common water ...
EKC31721      122 MEVIPQTQFIPLSEILCMVILDLNNKQVVATLDIIQERLNQCYKGMQIPAPPVIYDTLGTLIRERKI-FHTGSGYFVVTS 200  Pacific oyster
RLV97711       23 MNPLLQPCSVPLAEGIYWTISDMNADHVMVTQETLLEQLVKNYPGIAVPSHKVLHNILGTLIMERKI-YHTGEGYFTVTP 101  Gouldian finch
XP_019473054    1 MNPCSLSQSIPLAEGICCAISDMNAHQRMVTQKTLVEQLVKRYPGIAVPSQKILYNILGTLIKERKI-YHTGEGYFIVTP 79   turkey
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap