Conserved Protein Domain Family
Romo1

?
pfam10247: Romo1 
Reactive mitochondrial oxygen species modulator 1
This is a family of small, approximately 100 amino acid, proteins found from yeasts to humans. The majority of endogenous reactive oxygen species (ROS) in cells are produced by the mitochondrial respiratory chain. An increase or imbalance in ROS alters the intracellular redox homeostasis, triggers DNA damage, and may contribute to cancer development and progression. Members of this family are mitochondrial reactive oxygen species modulator 1 (Romo1) proteins that are responsible for increasing the level of ROS in cells. Increased Romo1 expression can have a number of other effects including: inducing premature senescence of cultured human fibroblasts and increased resistance to 5-fluorouracil.
Statistics
?
PSSM-Id: 402038
View PSSM: pfam10247
Aligned: 57 rows
Threshold Bit Score: 47.1702
Threshold Setting Gi: 548858470
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
CCG81328     12 MkaKMGALMGTTVGCCVGILFGGFNALRYGPGPQGFLRYIGQNMAASAAMFGGFMSIGSVIRT 74  Taphrina deformans PYCC 5710
XP_003245725 21 V--STSFMMGATIGITIGILFGGLGGLRSGYRGRELVGSMGKTMLQSGGTFGTFMGVGAALRC 81  pea aphid
1_pfamImport  6 I--ISGVALGLVLGAAGGVFTGTAMSLRMGFRGRVFSMRVLKHMSVGGAHGGVIFGVAQSLR- 65 
XP_003142407 21 M--KMGLLMGVFIGCASGAIIGTASAFSMGFRGRAMMAQVGRYSTKMGGSFAIFMMIAQGLRC 81  eye worm
2_pfamImport  6 I--LVGFVIGSTVGASVGALYGGFFGLRYGLRGRELFTNLGKAIIQSGGTFGVFMAVGSGLRC 66 
XP_001639758 13 V--KVGFMIGFAVGMSSAGLFGTYSALRYGLRGRELMSSVGKLMLQGGGTFGVFMSVGTAIRC 73  starlet sea anemone
XP_002407033 19 V--KMGFTIGFCVGMASGALFGGFSALRYGLRGRELIQSVGKVMLQGGGTFGTFMSIGTAIRC 79  black-legged tick
CDS36402     21 I--KMGFLMGFCVGMATGAIFGGFSCLRYGFRGRELIQTVGKGMIQGGGTFGMFMAIGTAIRC 81  Echinococcus multilocularis
XP_015785981 18 V--KMGFAIGFMVGMGSGFLFGGFSSFRAGLRGINLLTNTGKVMVQGGGTFGTFMAIGSAIRC 78  two-spotted spider mite
XP_002424734 17 V--KMGFAIGFCVGLVSGTIFGGFTAFRYGLRGKELVSNVGKVMLQGGGTFGTFLAIGSGIRC 77  human body louse
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap