3JD5


Conserved Protein Domain Family
MRP-S22

?
pfam10245: MRP-S22 
Mitochondrial 28S ribosomal protein S22
This is the conserved N-terminus and central portion of the mitochondrial small subunit 28S ribosomal protein S22. Mammalian mitochondria carry out the synthesis of 13 polypeptides that are essential for oxidative phosphorylation and, hence, for the synthesis of the majority of the ATP used by eukaryotic organisms. The number of proteins produced by prokaryotes is smaller, reflected in the lower number of ribosomal proteins present in them.
Statistics
?
PSSM-Id: 402036
View PSSM: pfam10245
Aligned: 29 rows
Threshold Bit Score: 319.13
Threshold Setting Gi: 405970082
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
3JD5_AA                      69 FMDEEVQSILIKMTGLDLLKIFKPAVQEt----kPPTYKLMTQAQLEEATRQAIEAAKVRLKMPPVLEERTPINDVLAED 144
EFX81875                     50 FFKENVQTLLERLTGRDCDKVFHNRKLGer--lePPKYELLTQAEVDHVMAEMEVKLKRKLQMPPLLKERDPIKKIYSFN 127 ...
EFN66644                     42 FFNRNVQSYLKRLTTVDYAKIFRTRKDGhr--lkAPEYKFLTDEELQEATEAAKRRAHKYLQMPPVVKKRVDPSVLLCED 119 ...
EGI59012                     42 FFNKEIQECLQTLTTLDYNKVFRTRKDGhk--lePPQFKFLTDEQLEEARKAAECRAKEYLQMPPVVKQRLEPSEPLCED 119 ...
XP_975160                    52 FIKKEVQTLLTTLTRVDLAKVYRKRKLGgrq-leQPVYKFMTDEQLQEALDEAKRKVDEILQIPPVVAVRKPRDKVVSRD 130 ...
Q17HE9                       53 FMREDVQKLLKSMTRLELDRVFRKRSVRd----nTVEYKFMTDDQVRREVMQSIGRADRMLQMPPVVDVMHENLKVLSKD 128 ...
WGS:AAAB:ENSANGP00000030885  54 FLRDDVQQLLKSITRLELDKVFRKRSVKd----nTVEYRFMTDEQLRRELLHSIEQAQQMLQMPPVVQEQQDSCRVISKD 129 ...
XP_004930388                 49 FFTPNVQNLLKRLTRPDFTKVFRKRNNQglhalkTPKYKFLTKEELELEIAKANEKADVLLQIPPVLKIHKPIDEVLSRD 128 ...
OWR55778                     47 FFSSGVQIILKRLTRPNFEKVFRKRTNSnisvlrTPVYKFLTDEELKIEQSNAYKSAERLLQMPPVVKVQEPVDDILSKD 126 ...
NP_001280451                 49 FFAEPVQNLLFKLTHVDVQKAFRKRFIGen--pdTPIYKFMTTAEVEKMQAEVKLKAKEKVQMPPIVPLRTDLGQVLEVN 126 ...
3JD5_AA                     145 KILEGTETGKYVFTDISYSIPHRERFIVVREPSGTLRKASWEERDRMIQIYFPKEGRRVLTPVIFREEN-LQTMYSQDRH 223
EFX81875                    128 PELQGFDDSKYVFINISQGITNRNREVVVRDPNGVLREASWEERQRMCQIYFPVPGRKINVPKMFEEGN-IQNCLDRDEF 206 ...
EFN66644                    120 PALKGHDTAKYVFTDITYDLNDKERPIVVREPEGTLRHATWQERDRIIQIYFPKPAREIEKPKMFEAEY-LKDLLDRNEY 198 ...
EGI59012                    120 PALQNHDTAKYVFTDVTYGLKDKQRSIVVREPDGTLRHASWKERDRMIQIFLPKPERELQKPKMFEGEY-LKDLLNRNEY 198 ...
XP_975160                   131 PALQGLDSSNYIFTDISYGVPDSERIILVRDTEGTLRDADWATRDRINQMYFPVARRQVTPPKMFEDDK-LDDLLKRGEY 209 ...
Q17HE9                      129 GALKGFSEAKMVFTDITFGLKNSKRTIVERLPDGTLQEAAYETRKRLNQIYFPLKGRYVRTPKMFEAGN-LKKILEAKEY 207 ...
WGS:AAAB:ENSANGP00000030885 130 GALKSLSTSKFVFTDITYGLKNSQRSIVVRHPDGTLQEAPYEMRKRLNQIYFPLTGRSIHQPPMFEDEH-LQRLLEEGKY 208 ...
XP_004930388                129 PALIGYDTSKYLFTDITFGIANEERIIIERDTDGTLRSCDHDIRKKLNQVYFPITGRKIREPHMFSDEEkFHNLLDRGEY 208 ...
OWR55778                    127 PALVGYDSSTYLFTDITYGVANEHRLIIQREPDGTLRSCDHDVRKKLNQIYFPMQGRKLRDPLVFSDPEkFNSLLERQKY 206 ...
NP_001280451                127 KDIIGFDSSKFVFTDITFGVSDKRRIVVVREPDGTLRKANEDERHAVNQIYFPQSGRELKHPVMFDDTN-LKPLLENGDY 205 ...
3JD5_AA                     224 VDVLNLCVAQFEPDSADYIKVHHQTYEDIDKYGKYDLLRSTRHFGGMAWYFVNKKKIDGLLIDQIQRDLVDDAASLVQLY 303
EFX81875                    207 EFVLDRACAQFDPDDPEYISVTRKTYDFVDENTKYTSLRPTRHFGPMVLHLVLSKKMDNLLFHFINTKDIDAAANLVRLF 286 ...
EFN66644                    199 IFILDRACVQFEPDDPDYQAVTREVYEHINREKHFDILRSTRHFGPMVFHLAWTRNIDNLLCEMIETGRIEHAAILIRLV 278 ...
EGI59012                    199 EFILDRACTQFEPDDLDYQAVTQEVYEHINAENHFDVLRSTRHFGPMVFHLVWTSNIDNLLYEMIETNRIKDAALLIRLY 278 ...
XP_975160                   210 NFILDRACLQFEPNDEFYQKVCSVTYQHINENNKFEDIRSTRHFGSFAFFIAWHKMIDNLLLDLIESEHIDEANALVELY 289 ...
Q17HE9                      208 EFVLDRACVQFEPYEKEYHNLTATVYLHVNENKEFDSLRSTRHFGPMAFFLAWHRLVDDLLLDMIKRDYLRNGVELIALF 287 ...
WGS:AAAB:ENSANGP00000030885 209 EFVLDRACVQFEPYEKDYHHITAKVYQHINESRSFDALRSTRHFGPFVFFLAWHKLIDDLLLDMIKQDYLRNGIELIVLY 288 ...
XP_004930388                209 EFVLDRACIQYEPDEPIFQKITSITYQHVDNNKCYNTLRSTRHFGSMTFYLTWHQSIDNLMLEIIQSGFIREAVLLAALR 288 ...
OWR55778                    207 EYILDRACVQYEPDDPQYQKLTSITYQHVDMNNQYNLIRSTRHFGPLAFYLTWHDSIDNLMLEMVQTGIIREAVLLMSLR 286 ...
NP_001280451                206 EFILDRACCQFEPDDKNYHRVVFSTYKHVDESKNYHILESTRHLGPLLFYLAFNKKPDNFLLYCLQTERFDDIILFIQLY 285 ...
3JD5_AA                     304 HILH 307
EFX81875                    287 HTVa 290 common water flea
EFN66644                    279 HLIY 282 Florida carpenter ant
EGI59012                    279 HMVH 282 Panamanian leafcutter ant
XP_975160                   290 AQLH 293 red flour beetle
Q17HE9                      288 ASLH 291 yellow fever mosquito
WGS:AAAB:ENSANGP00000030885 289 STLH 292 Anopheles gambiae str. PEST
XP_004930388                289 HDVH 292 domestic silkworm
OWR55778                    287 QAIK 290 Danaus plexippus plexippus
NP_001280451                286 TKLn 289 pea aphid
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap