2EQO


Conserved Protein Domain Family
MIP-T3

?
pfam10243: MIP-T3 
Click on image for an interactive view with Cn3D
Microtubule-binding protein MIP-T3
This protein, which interacts with both microtubules and TRAF3 (tumor necrosis factor receptor-associated factor 3), is conserved from worms to humans. The N-terminal region is the microtubule binding domain and is well-conserved; the C-terminal 100 residues, also well-conserved, constitute the coiled-coil region which binds to TRAF3. The central region of the protein is rich in lysine and glutamic acid and carries KKE motifs which may also be necessary for tubulin-binding, but this region is the least well-conserved.
Statistics
?
PSSM-Id: 402034
View PSSM: pfam10243
Aligned: 7 rows
Threshold Bit Score: 168.373
Threshold Setting Gi: 74962291
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
2EQO_A  12 VVRRTQEALGKVIRRPPLTEKLLSKPPFRYLHDIITEVIRMTGF--------MKGLYTDAEMKSDNVKDKDAKISFLQKA 83  human
A0BFP5   4 FWKPTADLYSALFEKPKMSQKLLEKPPFKYIFDIIMETTKQTGFkfkfplgyAKGLYTTDELDGNSYDNKDKKLMFLQKI 83  Paramecium tetraurelia
Q24FQ8   6 FWEPTIKLYTGFIKKPSMSEKLLAKPPFKYLFDIILATMDATGF--------GQGLYTDQEKDANYYENRDLKILFLRKV 77  Tetrahymena thermophi...
Q7PXJ3   9 VLKRTQSSLGKFVKRPALTEKLLRKPPFRFLHDIVHAIIREHGS--------LDGLYTADELNSDNIKDRDSKMAFLQKL 80  Anopheles gambiae str...
Q17595   2 SVEETREILEKVIQKPQLTDQLLSRPPFKFIVDIVSNVIKSTGY--------LKTDFTDDEIKSAG-NDKNTKTAFLDKL 72  Caenorhabditis elegans
Q4QC32   4 IIEKTQKELGAVIQAPKLTDKLLSRPPFRYIHDIVMSFMKATGF--------PDGLFDADQRDSAKVADKKAKVQFLEKL 75  Leishmania major
Q4CR32   5 YVEKTQTELGAIISSPKLTEKLLLKPPFRFLHDIVTSFLSATGF--------PKGLYPDALLDSSNVTEKTIKIEFLTQL 76  Trypanosoma cruzi
2EQO_A  84 IDVVVMVSGEPLLAKPARIVAGHEPERTNELLQIIGKCCLN 124 human
A0BFP5  84 IDLTSMMLKEEIAAKPGKIAAGLEPENTNLLLQAIYRAAVS 124 Paramecium tetraurelia
Q24FQ8  78 IDLIQYTNKSSLQAKPNKIVAGLEPEHTNSFLCELHRVATT 118 Tetrahymena thermophila SB210
Q7PXJ3  81 IDVVKLTTGRELKVRPSKIVAGLEPERTNELLQALASILEE 121 Anopheles gambiae str. PEST
Q17595  73 IKILDDGSLKNVKA--AKIISGKDAEETNKMLQMLGTNATS 111 Caenorhabditis elegans
Q4QC32  76 IAAVEAATGTPVAARPAKIVAGEEAEKTNELFQQLARCAAL 116 Leishmania major
Q4CR32  77 IAAVEAGTGKKVAAQPTKIVAGQEAEKTNELLQLLASCAKL 117 Trypanosoma cruzi
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap