Conserved Protein Domain Family
KxDL

?
pfam10241: KxDL 
Uncharacterized conserved protein
This is a family of short proteins which are conserved over a region of 80 residues. There is a characteristic KxDL motif towards the C-terminus. The function is unknown.
Statistics
?
PSSM-Id: 402033
View PSSM: pfam10241
Aligned: 73 rows
Threshold Bit Score: 57.9227
Threshold Setting Gi: 238030632
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
XP_001527218 138 SLLSALDSSDLDK-TLVVGAQLSGKLNNENQKLLEQRKILNESFTRLHQLFKQNFeTLGSDKLSRVERLNKNIKSIEARI 216 Lodderomyces el...
KJE89677      24 KITSGIDHGAVND-MLRQQRLILGRFERTNARLSRFNEHLDSVLGAHTARFKSYT-HQLVDAKKDLESIFRRIRALRAKL 101 Capsaspora owcz...
XP_015783294  34 SLLNLIDQNKIDG-IIDTQRHMMARFEKTNEMLVNCNALSLSRYEIAMKEVKRMS-QNLGEMKKDLDYIFKRVKFIRTKY 111 two-spotted spi...
Q7PNU4        35 GLAGLVNQTDVEV-MIRAQKQMLQRFEKTNEMLLNCNALSASRLKLATDDFKKHT-KLLHDMKKDLDYIFRKIRTIKTKI 112 Anopheles gambi...
Q2M0M3        36 NLAGMVNQGDVET-MIRAQKQMLQRFEKTNEMLLNCNALSQSRLKNANDDFKRHV-KCLYEMKKDLDHIFRKIRVIKQKL 113 Drosophila pseu...
EFA06928      29 GLAGIVDQQDVES-MIRAQKQMLQRFEKTNEMLTNCNALSANRLKTIGPEFKKHT-QLLLEMKKDLDYIFKKIRAIKTKL 106 red flour beetle
NP_001280369  29 GIAGIVNQEDVES-MIIAQKEMLQRFEKTNEMLTNCNSLSMSHLKTTSQDLKKHT-QMLAELRKDLDSTFKRIATIRSKI 106 pea aphid
EFX76607      29 GLAGFTNQHDIDH-IIRAQKQMLQRFEKTNEMLVNCNTLSQVHLQKANVEFKKHA-QLLNEVKKDLENIFKRIKIMKAKA 106 common water flea
XP_004991265  36 ALHGMVDNEQLQQhVLPKQQETLARLQQTTQTLVAQTQEADRKHIAVQHQYARYA-HLISAAKDDLMIIFRTLRSLQRHL 114 Salpingoeca ros...
XP_014287519  28 GLAGIVDQQDVES-MIRAQKQMLQRFEKTNEMLTNCNNLCVTRLKTASADFKKHT-SLLVEMRKDLDNIFKRIQVLKSKT 105 brown marmorate...
XP_001527218 217 EK 218 Lodderomyces elongisporus NRRL YB-4239
KJE89677     102 TQ 103 Capsaspora owczarzaki ATCC 30864
XP_015783294 112 NQ 113 two-spotted spider mite
Q7PNU4       113 GN 114 Anopheles gambiae str. PEST
Q2M0M3       114 QQ 115 Drosophila pseudoobscura
EFA06928     107 ST 108 red flour beetle
NP_001280369 107 KV 108 pea aphid
EFX76607     107 AS 108 common water flea
XP_004991265 115 RE 116 Salpingoeca rosetta
XP_014287519 106 SA 107 brown marmorated stink bug
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap