Conserved Protein Domain Family
Cript

?
pfam10235: Cript 
Microtubule-associated protein CRIPT
The CRIPT protein is a cytoskeletal protein involved in microtubule production. The C-terminal domain is essential for binding to the PDZ3 domain of the SAP90 protein, one of a super-family of PDZ-containing proteins that play an important role in coupling the membrane ion channels with their signalling partners. SAP90 is concentrated in the post synaptic density of glutamatergic neurons.
Statistics
?
PSSM-Id: 402028
View PSSM: pfam10235
Aligned: 42 rows
Threshold Bit Score: 65.8589
Threshold Setting Gi: 597570471
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
GAA91003      13 TELATPgvkrktEMYYgspattlggssssssgsgagagaaggKAKSSTLgSTGIGKSKLLSSKa---------KNPYAAy 83  Aspergillus kaw...
EFW19596      13 TELATPavkrknDMFYgstlstlg----------ggggggdsKRPSGTSgYAGVTKNKLLSSKa---------KNPYAAy 73  Coccidioides po...
EEQ31093      13 TELATPavkrksEMYYgspmsssag--------gggarsgdsKKSSATLgNTGVSKNKLLSKKa---------QNPYAAy 75  Microsporum can...
XP_008084535  13 TALATPgvkkknDMYYgspagst-------------srsgdkTKTSATLgNNGVGKSKLLSKAa---------RNPYAAy 70  Glarea lozoyens...
XP_007288292  13 TTLATPgvkkksEMYYgspags--------------skssdkPKTSATLgNNGIAKARGLSRPdfyfilknftENPYATy 78  Marssonina brun...
XP_007779717  13 TQLATPavkkknEMYYgspagnk-------------tastsgSKPSATLgQTGVSKSKLLSKSa---------KNPYAMy 70  Coniosporium ap...
EPE04900      13 TALATPgikkknEMYFgspas----------------ssasgSKKPATLgQNGIGKSKLLSKNa---------KNPYAQy 67  Ophiostoma pice...
XP_013958778  13 TKLATPevkkksEMYYgspas----------------tkasgSKS-ATLgNTGVSKSKLLSKAa---------KNPYAQy 66  Trichoderma vir...
EFY90208      12 TTLATPdvkkksEMYYgspaas--------------sskpsgSKS-TTLgQSGVVKSKLLSKSa---------KNPYAQy 67  Metarhizium acr...
XP_018162848  14 TTLATPaikkksEIYHgssasas-------------ssspsaSK--PTLgSTGIGKSKLLSKAa---------KNPYAQy 69  Colletotrichum ...
GAA91003      84 ASSCEVCKTKTEQGRKYCQRCAYQKNACPMCGKGL-TGSSSKNQ 126 Aspergillus kawachii IFO 4308
EFW19596      74 SSSCDACKTKIESGRKYCQRCAYSKNACAMCGKSLsTTKSTQKQ 117 Coccidioides posadasii str. Silveira
EEQ31093      76 SSSCESCSTKTNQGWKYCQKCSYRKHVCAMCGKSLnAAGTTKAQ 119 Microsporum canis CBS 113480
XP_008084535  71 SSSCTTCKTKIDQGRTYCQKCSYKANACAICGKAN------SKS 108 Glarea lozoyensis ATCC 20868
XP_007288292  79 SSSCSTCKTKIDQGRTYCHKCAYKANACAICGKKE------SKS 116 Marssonina brunnea f. sp. 'multigermtubi' MB_m1
XP_007779717  71 SSSCDKCKTKVDSGKKYCHRCAYKENSCEMCGKSL---TKSSST 111 Coniosporium apollinis CBS 100218
EPE04900      68 SSSCDKCKVKVSQGHKYCHNCSYKEDVCAMCGKPN------KKA 105 Ophiostoma piceae UAMH 11346
XP_013958778  67 SSSCTKCKTKITQGHSYCQKCAYQTDSCPMCGKPN------KKS 104 Trichoderma virens Gv29-8
EFY90208      68 SSSCTKCKAKVSQGHSLCQTCAYKNDSCAMCGKPN------KKK 105 Metarhizium acridum CQMa 102
XP_018162848  70 SSACSKCKTKVSQGHSLCQSCAYRADSCASCGKPN------KKA 107 Colletotrichum higginsianum IMI 349063
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap