Conserved Protein Domain Family
Cg6151-P

?
pfam10233: Cg6151-P 
Uncharacterized conserved protein CG6151-P
This is a family of small, less than 200 residue long, proteins which are named as CG6151-P proteins that are conserved from fungi to humans. The function is unknown. The fungal members have a characteristic ICP sequence motif. Some members are annotated as putative clathrin-coated vesicle protein but this could not be defined.
Statistics
?
PSSM-Id: 402026
View PSSM: pfam10233
Aligned: 82 rows
Threshold Bit Score: 66.017
Threshold Setting Gi: 1005963508
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
B2AR67        19 LGILSMILCFALGLSNmissIFSLNIViIAFSILAMVFSFVILFVEVPLLLRICPTSSSFDAAIRKISTNYMRAGAYGVM 98  Podospora anser...
XP_003420501  34 sGVLGAISCAISGLFNc----iTVHPLnIAAGVWMIMNAFILLLCEAPFCCQFVEFANTVAEKVDRL-RSWQKAVFYCGM 108 African savanna...
XP_005055684  33 AGVIGGMSCAFAGLWNc----vTINPLnIAAGVWMMLNAFVLFLCEAPFCCQFIEFASAVSARADRL-RAWQKAAFYCGM 107 Collared flycat...
XP_014340845  32 AGIFGGICCGLAGIWNc----vTIYPInIAAGVWMILNAFVLFLCEAPFCCQFIEFANVVSSRADKL-RHWQKGLFYCGM 106 coelacanth
XP_003965347  30 AGVLGGISCAIAGVWNc----vTVNPLnIAAGVWMVLNAFVLFLCEVPFCCQFVEFANAIAARADKL-RPWQKALFYCGM 104 torafugu
XP_015784887  27 vSTVAGLLSIFFGFWAm----iGFDFGcLLAGILLICEGLLVTLIESPCLCVFLDFALIPSRFYEGK-PHWWKAVSYALF 101 two-spotted spi...
XP_015789975  25 ivtglsLLQVVFGIITsi-sILSP--LcIPAGLLQVGAAIVVLAIEAPSFVTFIRFAQPIGIFFEDK-PLWIKCAAYAGL 100 two-spotted spi...
XP_001944970  35 lGTFAGIVNLFTGVWNgl-gLIFLNTDcLFGGIIQLLLGILLIALEAPFLCVFIDYMQKVSDVAENK-PYWTRAILYAGL 112 pea aphid
EDO34764      21 WGAFSALCCTALGFFVm----fTLSAScFGMGLMMIIVGAFVMAFEVPACCQYMGWMVTVSDWVEKHFKFWMRGVLYFLV 96  starlet sea ane...
EDV27441      65 FGTLAAVVCIINGIITv----iTVSPLcIAMGAYMILLGVGIFIFEAPLLCKQAESARTFHEFISNR-RFIEKAAIYILL 139 Trichoplax adha...
B2AR67        99 ALVIWLSCIsTRTSLIAAAVFLTLTGACYGLAGAKGQ 135 Podospora anserina S mat+
XP_003420501 109 AVVP-VVIS-LTLTTLLGNAIAFATGVLYGLSALGKK 143 African savanna elephant
XP_005055684 108 AAFP-VLLS-LTLTTLFGNAIAFATGVLYGLSALGKK 142 Collared flycatcher
XP_014340845 107 ALIP-VILN-ITLTTLLGNAIAFATGVLYGLASLGKK 141 coelacanth
XP_003965347 105 AVVP-ILLK-FSFTTLFGNAIAFATGVLYGLASLGKK 139 torafugu
XP_015784887 102 AVIP-FFIC-QGFSTILSCCLLAAASASYLVLSLGKK 136 two-spotted spider mite
XP_015789975 101 AIIPCLFGC-FGLFFLLGFLTSLGSASVYGLLLIGRK 136 two-spotted spider mite
XP_001944970 113 SLVP-ILLC-FGPSTLIASALVFCTGLLYGLMSVGKK 147 pea aphid
EDO34764      97 AIVP-IVMC-LEVSTFIGCGAIVITAALYGVLAIGRK 131 starlet sea anemone
EDV27441     140 SLVP-ILVC-FGITTLIGCGMVFITGVFYGLMAIGKr 174 Trichoplax adhaerens
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap