Conserved Protein Domain Family
CCDC85

?
pfam10226: CCDC85 
CCDC85 family
This entry includes human CCDC85A/B/C and C. elegans Picc-1 protein. Picc-1 serves as a linker protein which helps to recruit the Rho GTPase-activating protein, pac-1, to adherens junctions. Human CCDC85B suppresses the beta-catenin activity in a p53-dependent manner.
Statistics
?
PSSM-Id: 402021
View PSSM: pfam10226
Aligned: 15 rows
Threshold Bit Score: 173.431
Threshold Setting Gi: 92090801
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
XP_023183633  28 AEDVAKIPDEELLKWSKQELVRRLRQTETEKRAVIVEHGNLMREVNRRLQQHLTEIRSLKDVNQKLQEDNQELRDLCCFL 107 southern platyfish
XP_015194332  10 QRELGRLSDEDLLRSSKEELVARLRREEADKIAALLQRGRLIAEVNRQLQGHLLEVRELKAVNQRLQQDNRELRDLCCFL 89  spotted gar
A2CEM9         9 NRELSKLSDEDLLACTKEELVNRLRKEESDKMSALIQRGRLIKEVNKQLQGHLLEIRELKVINQRLQEENQELRDLCCFL 88  zebrafish
Q0V9L7        44 GRDLSKVTDEEMLSHSKEELVRKLREEEAEKMSALIQRGRLIKEVNRQLQGHLTEIRELKQVNHRLQEENRELKDLCCFL 123 tropical clawed...
Q15834         5 AGGLEELTDEEMAALGKEELVRRLRREEAARLAALVQRGRLMQEVNRQLQGHLGEIRELKQLNRRLQAENRELRDLCCFL 84  human
XP_022528990  10 RDDLSKISDEELFRLSKDELVRRLRKVDSEKMSLMVEHGNMIKDVNRRLQVHLHEIRGLKEVNQKLQDDNQELRELCCFL 89  Mexican tetra
XP_001374725  11 KEDLSKVPDEELLRWSKEELARRLRRAEGEKMGLMVEHGNLMKDVNRRLQLHLHEIRGLKEVNQKLQDDNHELRELCCFL 90  gray short-tail...
XP_012663047   9 SKDLSQVPDEELLRWSKVELARRLRYAQGEKVGLMLEHRGLLRHVNRRLHQHLLEIRSLKDVNQRLQDDNQELRELCCFL 88  small-eared galago
XP_011477970  23 AEDISGITDEDLLKWTKEDLVRRLRRSEADKMSVILDHGNLIREVNRSLQLHLNEIRGLKDINQKLQEDNRELRDLCCFL 102 Japanese medaka
NP_001307120  21 SEDLSKLTDEELLKWSKEELVRRLRRAEAEKMSVIVDHSNLIREVNRRLQQHLNEIRGLKEVNQKLQEDNQELRDLCCFL 100 zebrafish
XP_023183633 108 DDDRQKGKRVSREWQRLGRFSAGLMRKEVAVYLQKLKELEQRQMEVVQENLELKEVCFMLEEERAAataggg--ahtqgd 185 southern platyfish
XP_015194332  90 DDDRLKAKRLAREWQLFGQHAARVLRDDLGGYLQKLAELERLQGALLRENLDLKELCLVLEEECVG-------------- 155 spotted gar
A2CEM9        89 DDDRLKVKKLAREWQLFGHHAAKVMREDLGGYLKKLADLERMQDGLVKENLDLKELCLVLEEECVS-------------- 154 zebrafish
Q0V9L7       124 DDDRLKSKKLASEWQLFGYHAAKVLREDLGGYLKKLSELERRQEELMRENSCLSEVFLALEEDSGP-------------- 189 tropical clawed...
Q15834        85 DSERQRGRRAARQWQLFGTQASRAVREDLGGCWQKLAELEGRQEELLRENLALKELCLALGEEWGP-------------- 150 human
XP_022528990  90 DDDRQKGKKLSREWQRFGRYTASVMWKEVGVYQQKLKELEANQDTIMRENMELKEIILMLEEERSG-------------- 155 Mexican tetra
XP_001374725  91 DDDRQKGKKLSREWQRFGRHTAGVLWKEVALSQQKLRELEARQEALLRENLELKEIVLMLDEERSg-------------- 156 gray short-tail...
XP_012663047  89 EDDRQKGRKLAREWQNFGRHAADAVWHEVARSQQKLRELEARQEALLCENLELKELVLLLDEERTSlaaagga-gsgggg 167 small-eared galago
XP_011477970 103 DDDRQKGKRVSREWQRLGRYSASIMRKEVTLYLQKLKELELRQEEVIRENLELKELCLLLDEEKGGsfvggnlsggntgm 182 Japanese medaka
NP_001307120 101 DDDRQKGKKVSREWQRLGRYSAGIMRKEVTLYLQKLKELEQRQEEVVRENLELRELCLMLDEEKGSggtsgs--vgtggp 178 zebrafish
XP_023183633 186 PGCRSSIDSQNSLSQ-LGGGGPTPGl-LRDVGDGSSTSSAGSTDSP 229 southern platyfish
XP_015194332 156 ---RAEGSPAGS------SELSLPCl-ARDLGDGSS--STGSVGSP 189 spotted gar
A2CEM9       155 ---RSDSSPGGS------TDLNIPCmvARDVGDGSS--STGSVGSP 189 zebrafish
Q0V9L7       190 --IRHHASPVAA------SELSLLPcgPRDLGDGSS--STGSVGSP 225 tropical clawed frog
Q15834       151 ---RGGPSGAGGSGAgPAPELALPPcgPRDLGDGSS--STGSVGSP 191 human
XP_022528990 156 AGSRSSIDSQSSLTN-LNGGSSN----MRDVGDGSSTSSTGSAGSP 196 Mexican tetra
XP_001374725 157 AGSRSSIDSQASLTN-LAGGSGGAG--PRDVGDGSSTSSTGSGGSP 199 gray short-tailed opossum
XP_012663047 168 AGALISIHSQASLSGpLVGGAAGAR--ARDVGDGSSTLSTGSGGSP 211 small-eared galago
XP_011477970 183 GGCRNSIDSQNSLLL-VPGQGLL----MRDVGDGSSTSSAGSADSS 223 Japanese medaka
NP_001307120 179 AGCRNSIDSQSSLSH---ASGPGPGl-LRDVGDGSSTSSAGSTDSP 220 zebrafish
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap