6TJV


Conserved Protein Domain Family
ChpXY

?
pfam10216: ChpXY 
CO2 hydration protein (ChpXY)
This small family of proteins includes paralogues ChpX and ChpY in Synechococcus sp. PCC7942 and other cyanobacteria, associated with distinct NAD(P)H dehydrogenase complexes. These proteins collectively enable light-dependent CO2 hydration and CO2 uptake; loss of both blocks growth at low CO2 concentrations.
Statistics
?
PSSM-Id: 402013
View PSSM: pfam10216
Aligned: 45 rows
Threshold Bit Score: 543.735
Threshold Setting Gi: 81709398
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
6TJV_P             23 IIYRLEAGGALIPDTPVNLMKIIGMYKAYSIPMDFYWRDLLYLGERVFINPFPFFKYFptkeyfelpnhyagdtadlriw 102
Q2JHX4             20 VVHRLEAGGSMLPDTPENLMQIIGLYKAYAVPMDFYWRDLLYIAEQVFVDPLPFFKFIipeeylklanhyagdnadlriw 99  Synechococ...
jgi:Cyan7425_4859  49 IVHRLEAGGGLLPDSPENLMRVIGMYKAYAVPMDFYWRDLLYLGERVFIDPLPFFKYFptqeyfdlpnhyagdnadyriw 128 Cyanothece...
Q8DKF3             23 IIYRLEAGGALIPDTPVNLMKIIGMYKAYSIPMDFYWRDLLYLGERVFINPFPFFKYFptkeyfelpnhyagdtadlriw 102 Synechococ...
ASGPB:GKIL_0121    18 lsQRLEAG-GLLSHSDDNLLEVVGILGSYGIVLDGYSRNLIYIAEHQFLVSLSPFKYF---------------------- 74  Gloeobacte...
Q7NHA7             77 VARRLAAA-ALLPESRDNVLEVVGVLHSYSFVLEAYSRNLLFMAERQFLHAFPLFKYL---------------------- 133 Gloeobacte...
ASGPB:GKIL_4347    18 IVERLEAGGALLPDSPENLLEVVGILKSYGEVLNAYQRNLLYIADRQFLVFFPFFKYF---------------------- 75  Gloeobacte...
Q7NIV1             16 VILRMEAGGALLPDGSDNLMEVVGVLKSYGVVLDAYWRNLLYIADRQFLVFFPFFKYF---------------------- 73  Gloeobacte...
Q2JKM3             28 IVQRLEAGGALVPDAPANRLEVIGILHSYGEVLDAYSRNLIFIADHQFLELFPAFKYF---------------------- 85  Synechococ...
Q8VPV3             17 vLERLEAGGALLLDTPDNLLEVVHILDSYGVVLDAYSRNLCYIAENEFLVLFPFFKYF---------------------- 74  Synechococ...
6TJV_P            103 rgpahahpelmefieKGEt-GKMPRLLHHLWHDRINMEFSEDLARAMMWHr--MGGQLDIYLDSEEYKAAADKAIRAYFK 179
Q2JHX4            100 rgpatahpellefmeKGElkRKLPRILHHLWHDRINMEFAEECMRAMLWHrdmG-GLLDPYMDSEEYKQNADRAIRAYCQ 178 Synechococ...
jgi:Cyan7425_4859 129 rgwekahpelmefieKGEt-GKLPRLFHHLWHDRINMEFSEDLARSMMWHr--MSGPLEAFLDSEEYITNANRAIEAYLL 205 Cyanothece...
Q8DKF3            103 rgpahahpelmefieKGEt-GKMPRLLHHLWHDRINMEFSEDLARAMMWHr--MGGQLDIYLDSEEYKAAADKAIRAYFK 179 Synechococ...
ASGPB:GKIL_0121    75 ---------------NGK--VTFKKLVDHSLHHRLNYEYAEYCARTLYWH---GNQKLNDYLQGPEFGGRAERAIRAKFH 134 Gloeobacte...
Q7NHA7            134 ---------------NGE--IHPRKLLAHWSQDRLNYEYAEYCAKTMYWH---GIPKLHDYLQGSEFKVLAERAVHARLQ 193 Gloeobacte...
ASGPB:GKIL_4347    76 ---------------NGE--VTLNKLLDHWAHERINYEFAEYCMKAMLWH---GAPKLDAYLDSPEFSERAERAIKARLK 135 Gloeobacte...
Q7NIV1             74 ---------------NGK--VSLPKLLDHWAHQRINYEFSEYCMKAMLWH---GAAKLDAYLDSPAFAERAERAIRAKIK 133 Gloeobacte...
Q2JKM3             86 ---------------NGE--ITLGKWLRYLWHDRINYEFAEYCMKAMLWH---GGGGLDRYLDTPEFVERAKRAIRAKIR 145 Synechococ...
Q8VPV3             75 ---------------NGQ--VTPAKLWQHWVHDRINFEYAEYCMKAMFWH---GGGGLDTFLDGPEFRELADRAIRARWR 134 Synechococ...
6TJV_P            180 RNPL---MLGLYKLFPDLFLEQARQATYMNVLGLFWEVMAPVFFEISDRYDEGSITSVKDAMNFLVNGIFAIAGRPIYHH 256
Q2JHX4            179 GNPL---LMGLYKLFPDMFLELCRQATMYSVLGLFWEVMAPVFFEMSDLYDEGKITSVPEAMNFLVNGIFAIAGRPIYHR 255 Synechococ...
jgi:Cyan7425_4859 206 SNPLyapLIVLHKAFPQMFLEQARMATYMSILGLFWEIMAPVFFEISDLYDEGKIQTIPDAINFLVNGIFIAAGRPIYHH 285 Cyanothece...
Q8DKF3            180 RNPL---MLGLYKLFPDLFLEQARQATYMNVLGLFWEVMAPVFFEISDRYDEGSITSVKDAMNFLVNGIFAIAGRPIYHH 256 Synechococ...
ASGPB:GKIL_0121   135 NNPA---ALALHKVFPITLPEQVRKLCYYHILGQFWRVMSSIFLSLAERYDQGQIQSIPDVVTHIANGLGKAADQPLTYS 211 Gloeobacte...
Q7NHA7            194 GNRA---ALFAHKLCPAFLEELVRRTCYYHVLGQFWRVMSRIFSTLAERYAHGEIRSIPDIVRHIAAGLGAAANLPLTYS 270 Gloeobacte...
ASGPB:GKIL_4347   136 GNPA---AQLLHRCFPDFLPEWVRQQCYYSVLGQFWRVMYALFLTLWERYERGEIRAIPDVVQHILENMGAAANDLLTYS 212 Gloeobacte...
Q7NIV1            134 FNPA---AGLLHRIFPDFLPEWARQSCYYSVLGQFWRVMSPMFLILSDRYDRGEIRSIPDVVAHIKDGLVEAANLPLTYA 210 Gloeobacte...
Q2JKM3            146 FNPF---LQGLGILFPDFALEQVRMLAMYSGLGQFWRVMSDIFLALAKRSETEPHLTIPDVVAHIQQGLVAAADKPITYA 222 Synechococ...
Q8VPV3            135 SNPV---MLGLHQLFPDFWPELIRQSAYYSALGQFWRVMSDMFASLAARYAAGEIRKVPDVATHVRDGLVAAAAIPITYS 211 Synechococ...
6TJV_P            257 VYIDDEVHVLVPKEKGFMWLYEAAFPYVEAVFYRTSPFRGTKSYNAQANQVPTDQVDFHYGILFADKFPVGTAGIPPTLL 336
Q2JHX4            256 VRIRGEWYDIVPKSKGFTWLYEAAFPYVEAVFYRTSPFRGTKSYNAQANEVPTNQLDFHYGILYADKFPVGTAGIPPTLL 335 Synechococ...
jgi:Cyan7425_4859 286 VYIKGKCYEIIPKSKGFMWLYEAALPYVEAVFYRTSPFRGTKSYNAEAGEVPEKQEDFHYGILYADKFPVGTAGIPPTLL 365 Cyanothece...
Q8DKF3            257 VYIDDEVHVLVPKEKGFMWLYEAAFPYVEAVFYRTSPFRGTKSYNAQANQVPTDQVDFHYGILFADKFPVGTAGIPPTLL 336 Synechococ...
ASGPB:GKIL_0121   212 VPIDGKTYELIPAEAELRWVSEAAVPYVEIVFFRAIPFRGTVSYTSDAAQIPAERDAFSYGVLYADPLRVGAAGVTPMLL 291 Gloeobacte...
Q7NHA7            271 VQFGDEEYELLPARAGLHWLADAAVPYAEIVFFRAAPPKGVFSYDASAG-LPGELADFCFGVLYANPMTLGVAGVAPTLL 349 Gloeobacte...
ASGPB:GKIL_4347   213 VKIRGEEYVIIPASADLRFLMDAAVPYVEAVFFRSAPFMGTVSYNAQAGQIPFEQADFQYGALYADPLPIGGAGIPPTLL 292 Gloeobacte...
Q7NIV1            211 VDIRGEHYELIPAEAGLHFLMDAAVPYVEAVFFRSFPFMGTVSYNAQAGQISENQADFNYGALYADPLPIGGSGIPPTLL 290 Gloeobacte...
Q2JKM3            223 PCIWGRRYEIIPLSAGLTFLSDTAIPYVEAVFFRSFPFMGTVSYNAQAHQIPAEQADFAYGALYADPLPVGSAGIPPTLL 302 Synechococ...
Q8VPV3            212 VEIDGDRYDILPASAGLTFLADTAIPYVEAVFFRGTPFPGTVSYNAQAHQIPDEQNQFAYGALFADPLPIGGAGIPPTQL 291 Synechococ...
6TJV_P            337 HQDMYHFLPQYLKDYFHQHCRGEDDILVQLGIAFQHAMYTVTSAVLQATRAafyYPLDDPNPEHLMANRRFFVAQMDRFL 416
Q2JHX4            336 HQDMYHFLPQYLVEYYRKHCRGEEDMLIQLGVSFQRSMYNVTSAVIQAGRAaflYPLDDPNPRHLMMNRRYFEGQLNRFT 415 Synechococ...
jgi:Cyan7425_4859 366 HQDMSHFLPQYLREHLLRNCRGEGDLLVQVGISFQRSMYTVTSAVIQALRAallYPLDDPNPKHLVANRAFFEGQLNRFL 445 Cyanothece...
Q8DKF3            337 HQDMYHFLPQYLKDYFHQHCRGEDDILVQLGIAFQHAMYTVTSAVLQATRAafyYPLDDPNPEHLMANRRFFVAQMDRFL 416 Synechococ...
ASGPB:GKIL_0121   292 MQDLHRFLPDFLRRHYREDTRSREAINIDMNKTFQKSMFCVTNAAVLALAP-----LSAGGPESAELRRAYFDTWAQRIV 366 Gloeobacte...
Q7NHA7            350 IRDLHRHLGAPLLSHYEGQAGDAAALVVAIGKSFQKAMFCVTNAAVLGLAP-----------DEAAGRRAHFDGWAARIL 418 Gloeobacte...
ASGPB:GKIL_4347   293 MQDMKQHLPEILRHEYLGSLRGEEDMRVQICVSFQKSMFCVTTAAIQALAP---YPLTTTRPEQRQANRAYLDGWMKRLA 369 Gloeobacte...
Q7NIV1            291 MQDMKQHLPKYLREYYLGSLRGEEDMRVQICVSFQKSMFCVTTAAMLGLAP---YPIDTDGPDQQRANRAYLENWMDRLM 367 Gloeobacte...
Q2JKM3            303 MQDMMRHLPPYLREHYRRQPRGDDDLRVKICLSFQKAMFCVTTAALRALAP---FPLETQDPQQQLANRKFLAPWLQRLL 379 Synechococ...
Q8VPV3            292 MQDMVHYLPPELQEFYAHRTRGSRDVRVKICESFQKSMFCVTTGALMGLAP---HPLTTQVPEQQLANRQFLQPWLDRIS 368 Synechococ...
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap