6EZN


Conserved Protein Domain Family
Ost4

?
pfam10215: Ost4 
Click on image for an interactive view with Cn3D
Oligosaccaryltransferase
Ost4 is a very short, approximately 30 residues, enzyme found from fungi to vertebrates. It is a member of the ER oligosaccaryltansferase complex, EC 2.4.1.119, that catalyzes the asparagine-linked glycosylation of proteins. It appears to be an integral membrane protein that mediates the en bloc transfer of a preassembled high-mannose oligosaccharide onto asparagine residues of nascent polypeptides as they enter the lumen of the rough endoplasmic reticulum (RER).
Statistics
?
PSSM-Id: 402012
View PSSM: pfam10215
Aligned: 50 rows
Threshold Bit Score: 32.5321
Threshold Setting Gi: 196049113
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
6EZN_D         1 MISDEQLNSLAITFGIVMMTLIVIYHAVDSTMSP 34  Saccharomyces cerevisiae S288C
XP_002428412   1 MITDIQLAIFANALGITLFLLVVIYHYVAANYSK 34  human body louse
CCD80633       1 MITDVQLTVFANLAGSVLFLLVVLYHYVIVNQKT 34  Schistosoma mansoni
Q6BEV3         1 MISDVQLGIAANILGIAMLMLVVLFHYLNANQKN 34  Caenorhabditis elegans
XP_019079527   1 MIDDQDLGFFANFLGIFIFVLVIAYHYVIADPKY 34  wine grape
XP_014621343   1 MIDDETLGAIANFLGIFIFALVIAYHLVTADPKY 34  soybean
Q8L986         1 MFDDQDLGFFANFLGIFIFIMVIAYHFVVAEPKF 34  thale cress
A1Z7U3         1 MITDVQLAIFSNVLGVFLFLLVVAYHYINANTGK 34  fruit fly
B0BLS0         1 MITDVQLAIFANMLGVSLFLLVVLYHYVAVNNPK 34  Norway rat
Q54V54         1 MITDTQLTLLSNTLGATIFLLIVYYHYVATKTVT 34  Dictyostelium discoideum
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap