Conserved Protein Domain Family
Rrn6

?
pfam10214: Rrn6 
RNA polymerase I-specific transcription-initiation factor
RNA polymerase I-specific transcription-initiation factor Rrn6 and Rrn7 represent components of a multisubunit transcription factor essential for the initiation of rDNA transcription by Pol I. These proteins are found in fungi.
Statistics
?
PSSM-Id: 402011
View PSSM: pfam10214
Aligned: 48 rows
Threshold Bit Score: 282.875
Threshold Setting Gi: 74582216
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
XP_008096987    6 TPTAQPLLAITQMADVANHTRvv-pVPVLAMAAGESGELLRLSKM------S-ETKWQWGENE--SPTLRVF------SI 69   Colletotrichu...
CCD26231      182 DPIVGDLIDVGIIQTLNDIRKgvdgTEIIVYVCGNTSSTLCISRY--------TDDSSYLLPT----------------- 236  Naumovozyma d...
Q6FVC9        209 DPNTDFLVAIGKVLTKADIKNdqeeRALVAYRHPLSPSNLIITYM------EkENITVQNKEKadSNVI---------IY 273  [Candida] gla...
EJT41526      172 DPTVANRLEIEHIQTASDLRNyrdgTEVIAYASGKTNSLLNVGVL--------TRQDTLHLNRhnNVT------------ 231  Saccharomyces...
XP_003682278  179 DPAVGSLLITGAVQTIPDLRNnynqHHIIAFSCGKTNSILKIGLLeytspsS--------------------------LT 232  Torulaspora d...
CAR29481      187 DPVVNDLFVAGNIQTARDLRSnsdqQTVIAFCSGETNSILKLAVL------PeNKLHLANGAQwlQELFAKNvddelgTF 260  Zygosaccharom...
XP_003685981  181 DPNTGELMVIGLLQTVADLRAnkdpQQVIAYVSGNSDSVLNIAVL------TrSKKEFIKVDKhtKVPGKTW------EI 248  Tetrapisispor...
EDO18462      181 DPTISGLLHVIKIQTVSDLRNgkdpHNFVVCVSGNSRSRLVLGVM------DdDYVPLSEPDTamETKARTW------FI 248  Vanderwaltozy...
XP_004197605  121 DPTYDSLTCTFRIRNHDDVV-----SKVFVYVTGETGCILNLCEM------RmSTHRLFSSKKgtYHGIA--------NI 181  Pichia farino...
EAZ62994      124 DPNYENLFALFKVQMKGSSQT----FRSIAYVSGESGNILNIGLV--------NSKGIEARNKfnKESFIKL------LI 185  Scheffersomyc...
XP_008096987   70 DQHDREetvlWSSDGAPILQIKAALSLVrfePT-RWLLVQKRTSTTILQPEYhkvpvserpsgIDKATERPSRINPKPIL 148  Colletotrichu...
CCD26231      237 ----------YINLQSPIKNIKIGRLSKnmlRAsDCIGILTENSFYVLKL-------------HQLHDPE-SNLSYILYG 292  Naumovozyma d...
Q6FVC9        274 RPSQKTytsiTINLNSVIKCIKFSKLAEslgSYsDMVGVLTENTLTVIKL-------------IKFDAKE-KKIDYTLFN 339  [Candida] gla...
EJT41526      232 ----------SIELHSPIRSIKIPRTSEsigRRsNLVGVITENSFQIFRI-------------ESIHSKS-CDVVITSSE 287  Saccharomyces...
XP_003682278  233 EQIRQAa---SIQLGSTIKGIKLPEYSSmldRRsDLIGVMTESALHVIKI-------------ECITSR--MEIKTSVCE 294  Torulaspora d...
CAR29481      261 A---------SIDLKASIKSIKIADVSSllgRCsDTVGVLTENALHFIKI-------------DNIDPQT-SHISYSMHE 317  Zygosaccharom...
XP_003685981  249 KDQKSIe---SIELNSPIKKILFPQLSAifrRMsDLIGILTENSLHIIKV-------------SNFNCQT-LKFKFQQYK 311  Tetrapisispor...
EDO18462      249 KTSKNIv---NIPYQTQIKKIVFPKLSDmfdRTpDMFAVITDTFIQIIKI-------------TNINSTS-GNITYSLSE 311  Vanderwaltozy...
XP_004197605  182 PDLGKPf---KVTISEPIKQVGSKEASNalqPFp-IIIVRTDHKIFVLTSE------------PSEKGKKGVNFGLEMIG 245  Pichia farino...
EAZ62994      186 PELSRSf---QISLSEPIKQIEI--AREvfdYTpSYIVVRTSSKVYVLFCRI-----------PAIQTKSLVNLEVSVLG 249  Scheffersomyc...
XP_008096987  149 AITSEQTGGFAHSDVSFSYGSRKnppQLAIVDECGYYSVWDIKG--RGVLGSV--------SMRPKLRHCGHIqlgateq 218  Colletotrichu...
CCD26231      293 PLTFNEFNDFTFADFAFNPWDIE---EFALVDIKGNWIIGSIPKlnKHAATG---------KLFLKRHFSGTIfd----- 355  Naumovozyma d...
Q6FVC9        340 PLESRLISDFTIADFDFNPWDTD---IIATIDTKGNWSIIEIPTvkKKMPNPEs------lNLKVKSNHFGSIfd----- 405  [Candida] gla...
EJT41526      288 PLYFVEVDDMQIVDFAFNPWDLQ---QFATIDVRGNWNIGMIP---KNFNNNKr-------KLQLIDNLHGTIfd----- 349  Saccharomyces...
XP_003682278  295 PLPFQDFSDFPFADFAFNPWDLQ---QFAVIDVKGNFGIGRLP---KSFKIGH--------KARILREYGGSIfd----- 355  Torulaspora d...
CAR29481      318 PLKSTSFGDFPFADFVFNPWELQ---QFAVVDIKGNWGVARLP---KAIKPGS--------RIRFLPNLKGSIfd----- 378  Zygosaccharom...
XP_003685981  312 YLSYSSLGDFPFADFAFNPWDMN---ELAVIDIKGNWAVCSIS---SSLLKDD--------TIRVSQDARGTIyd----- 372  Tetrapisispor...
EDO18462      312 KLKFNEFSDFPFSDMAFNPWDMN---EIAVVDIMGNWSIGKIK---KSLNNSW--------KISLVNDMSGSIfd----- 372  Vanderwaltozy...
XP_004197605  246 EIGYGSLKGHEFAHFSFDPYEDF---QFSVIDVKGNFGFWEIKYgpRNKSVKRiqlkrnemEETLPNTSEYSIhd----- 317  Pichia farino...
EAZ62994      250 CIESKDLACNELAHVSVNPYDFS---RFAVIDIKGHFGLWTISFdsVKKFNMD------------SSQCSPSLed----- 309  Scheffersomyc...
XP_008096987  219 lpdedspaFRTEPHGVLWVgssgpgvdlwdvptaedpdtgndlaaltARSKKLLLWNRTKFEVIDVKNPSfRKSLTVLKS 298  Colletotrichu...
CCD26231      356 ------ieEQSRWKKIEWS----------------------------LSSSRILILNRSQMVEVDYRENW-QLQIIEAKT 400  Naumovozyma d...
Q6FVC9        406 ------ieEMSNWKRIRWS----------------------------NNHTRLVVMNESRLIELDFKQNW-QQEVIQAKT 450  [Candida] gla...
EJT41526      350 ------peELSSWKKIEWF----------------------------SQFQRILVFDRSKMIEIDFINGW-QAEVVQAKT 394  Saccharomyces...
XP_003682278  356 ------peELSNWKKIEWS----------------------------SSFSRLLVMDRSKMIELDFRQDW-QLEVIQSKT 400  Torulaspora d...
CAR29481      379 ------peELSNWKRIEWS----------------------------SSYSKLLIIDASKMVELDIENDW-QLEVVQAKT 423  Zygosaccharom...
XP_003685981  373 ------peELSNWKKIEWS----------------------------SKFTKLIVMDRSKLFEIDFQKDL-QVEIIEAKT 417  Tetrapisispor...
EDO18462      373 ------eeELSNWKKISWS----------------------------SSYTRLVIMSRSQMIELDFMQNW-QITIVEAKS 417  Vanderwaltozy...
XP_004197605  318 ------plELSNWKKIFWG----------------------------NSNTNILAFSRSSITQFEVDKSAkGERLVTFNT 363  Pichia farino...
EAZ62994      310 ------ctELSNWKRIQWI----------------------------YDSNHLVVLTRASVTQFTVSPKLqSRRLITSNT 355  Scheffersomyc...
XP_008096987  299 depdYILDVKSNPVSRSQVFILTSSCLFWIEts--spGTATVKQGSLTILQSFAHMRVSDADTLRLSVHHDGngsgdeAC 376  Colletotrichu...
CCD26231      401 w--sRLRDYKR--VDDTISVLLTSREIIIIStkd--------ndgDLKRELSWKHDLDPSDCTIRMFIQRRRept-vnLF 467  Naumovozyma d...
Q6FVC9        451 w--sKIRDVVD--LNDNFKLILTSREIIVTTinssknTRDSNHKINLKREVSWLHNISEDDASLRCRVQKYQfqr-ktlF 525  [Candida] gla...
EJT41526      395 w--sNIRDYKR--VDDENGILLTSREIIIMGase---------anDAVRRISWKHDLDPDDTTLKVAIQKVKmld-rlLL 460  Saccharomyces...
XP_003682278  401 w--sRLLDYQR--LDDDYGILLTSREIIVIStkq--------tseHISREVSWKHDLDPNDSTLRFCIRKVNsgg-kkLL 467  Torulaspora d...
CAR29481      424 w--sYLRDYRR--IDDEFGALLTSKEIIIVStks--------gneQVSRVISWKHCLDPTDQTLRLSIQKMPlgf-kmLI 490  Zygosaccharom...
XP_003685981  418 w--sRLRDYKR--IDENISVLLTTKEIIAIRtnk--------ntnCFDRILSWKHDLDPNDNTLKFSIQKIIkdk-vlTL 484  Tetrapisispor...
EDO18462      418 w--sTLRDYKR--VDDKMSVLLTSKEIIFLDtns--------kndQITRKLSWKHDIS-LDNTIKFSFHLIKgee-etEI 483  Vanderwaltozy...
XP_004197605  364 w--sTLQDVQYS-NNHDFLFVLTSKEIIWFKv-----------GPTLERLLSWKHFLDDNDPSLRISFMETTcdkgetSF 429  Pichia farino...
EAZ62994      356 w--sRIQDFATLGES---SFLLTSKELIWFK-----------SESTMTRLMSWKHFLDDSDPSLRFQVTETKqe---rRY 416  Scheffersomyc...
XP_008096987  377 ALYLYSEKSPEVEVYWFSIPEATR------------LPQfehhvvrlDN----NPSKLQAMCPVPAfLNstSSAASKGPG 440  Colletotrichu...
CCD26231      468 SMFITSKRHNKVYVHVFSIDSDDKilqsydeskllnIPG--------------LENGIDSIAFE-------YLGQDTYEG 526  Naumovozyma d...
Q6FVC9        526 FVYLYSKRFNVVYIHGFSIGY-NDtiqsfgvskiiyIPG---------------IYNIDSIDVE-------TLEINDYYT 582  [Candida] gla...
EJT41526      461 VAFVYSMRHNHIYVHAFSRKK-SNlfqslgystvleISNg-------------ASTGIEVILTLDEiN---GEEQGERED 523  Saccharomyces...
XP_003682278  468 LVSIFSRNHSFLYIHPFLMNGDESliqsagsstilqIPH--------------IKNGLRGIWLHDS-----TINDLNESQ 528  Torulaspora d...
CAR29481      491 LTCIFSKGHDKVYVHGFCHDQDRHlvqavngpilicMPH--------------VFKGISSMHFLP------YNEEERWIA 550  Zygosaccharom...
XP_003685981  485 IIYIFTSQSNNVYMHAFSIDTFNLqlttscqsnvmtIPN--------------ITEGIQTISVPDEsYDddDDYDMNDSY 550  Tetrapisispor...
EDO18462      484 IIFIYSKKHPLLYVHVFSINV-EGllqasknsrvitLPG--------------VSNGIGDVTFIDSpNLe-SDQIYSTDT 547  Vanderwaltozy...
XP_004197605  430 LCIIYSAVSPIMTIYNFGIRNEKphs--------lkDPYfier-tedSAinqnNLRGVFITELNADfFG--TKDDNDITM 498  Pichia farino...
EAZ62994      417 CCLIYSQVYSLIFVYNFAYRDGKpfs--------lhDPYyl-----rREgskaDLRQVALMDISREfYYsnQEKDDFVDE 483  Scheffersomyc...
XP_008096987  441 ADYMNQQVKFQQLFVLGRDLSLSQSLLAisasp----------------------------vlevvPPDNSREW---SRD 489  Colletotrichu...
CCD26231      527 NATEPVQREYKMFIRNNDDLKVLVFLVNssvlpdqeq---------------------ehisdsdlKLAEGSTVpdtYSD 585  Naumovozyma d...
Q6FVC9        583 DSIDLGDITSTLLIYDIVGNKLINYTLNnsanfdniq--------------------lnnmaierfRGPLVKYPipnVQA 642  [Candida] gla...
EJT41526      524 NGDNNVRVVVNFSIKLRNSSKIYYYTLSnaqtskfneqekfvag-----------dcnewtllfnnadsreMESigaLIS 592  Saccharomyces...
XP_003682278  529 KLDIFQEVCLSLFVNETDGGKLWHYIISndstklenwgtytd----------asrtnlsdveidvlWPKHMHHKldqIKK 598  Torulaspora d...
CAR29481      551 SDTQGQKLWLNFLFKDNSTNRLMHCFLTndelsd--------------------------pqdqlfVTPERMDAvpsLLP 604  Zygosaccharom...
XP_003685981  551 ENSSTEYVWINMFLKQYTSNEVTKVIVTnaplhitknknhvh----------fktdpnsegglkmrYKMKELQEmdnLIQ 620  Tetrapisispor...
EDO18462      548 ENSSWNTSWINVYVKENKTSVVHRFILSrsrshelngnnn--------------qsettkilndeiEGEINQHTipvSVE 613  Vanderwaltozy...
XP_004197605  499 ESQNAEDAKVYGIFTLNNNLRLTVTCFTdipglemkskhllyenrsdlsssteslnhinshrkekdR-----YFkrfSKE 573  Pichia farino...
EAZ62994      484 SDSECIISRNYGLFELTTDLSLTFRCFSelpnytlssidad-------------lsaleednrkekNHPTHLHFrslSKK 550  Scheffersomyc...
XP_008096987  490 GQGQAQNKRRREFLQHFEDTFVVPDGLGdldelvqrrtnryqelmdielegsgqriqqrwprpqnfdlfmsririsiesv 569  Colletotrichu...
CCD26231      586 NLLSLFTELDNKLNDDKVPAYAVEEEGD---------------------------------------------------- 613  Naumovozyma d...
Q6FVC9        643 LFKELQKEYLYAIRQYRKITRQKQRD------------------------------------------------------ 668  [Candida] gla...
EJT41526      593 QIKMKESEHISRIQSLVEDENSHGEDKY---------------------------------------------------- 620  Saccharomyces...
XP_003682278  599 SITFTKTDKEDTAAEDK--------------------------------------------------------------- 615  Torulaspora d...
CAR29481      605 PIARHIDQVRFFIGQTKVTMFEEPETPI---------------------------------------------------- 632  Zygosaccharom...
XP_003685981  621 LLTEKYKDYPSNKNENIHD------------------------------------------------------------- 639  Tetrapisispor...
EDO18462      614 VYLHKIFENLFDFDSKIDDSQNIYD------------------------------------------------------- 638  Vanderwaltozy...
XP_004197605  574 EFLNFLDTALLGRELTPEND------------------------------------------------------------ 593  Pichia farino...
EAZ62994      551 NVTKLLDFLVEPEEIFYDQSL----------------------------------------------------------- 571  Scheffersomyc...
XP_008096987  570 vMASEHTNIEGPLSVFDAIQEAVVNCLETEGgyi------plhTLHEYETtFEAPPLTREAVAAwdsRFQELLGaqteri 643  Colletotrichu...
CCD26231      614 ------IFQEYGYRLSDKMNQYLENAFAVTResvlp--fdlclKVEDLTD-VPGYIHDFSEFES---LLDQFFQyyndqd 681  Naumovozyma d...
Q6FVC9        669 ------NLQDFGYELSQKLN-KVIEDSHDVRskt-------siKLQSLMP-KIPVQSDLTEIQS---FLEQLSEhyselg 730  [Candida] gla...
EJT41526      621 -------LQDLGYRLSMATN-ELLESWERTRdenirsgsmsysKLENLVE-DSNSFTSIPEFVS---LLDQFFRyykdqd 688  Saccharomyces...
XP_003682278  616 ------LLQAYGYQLSEAIN-ELLIDWNDPQesll----gtqpLIKDLVE-IPHDF-NLKEFGS---MLSQLFNhyhdqa 679  Torulaspora d...
CAR29481      633 -APDSEIFQNFGYQLSEAIN-GIVESWENQQmdie----qvqpLLSDLTN-VPTKYESMEELES---LLHQLSEyyrdlg 702  Zygosaccharom...
XP_003685981  640 ------LLQDFGYKLSTLLNEEMVHFNKENRsnll-----knrSLKDLID-LSPSIENLSEFES---FLDQLIEhfeess 704  Tetrapisispor...
EDO18462      639 ------LFQSFGYKISNELN-GFIDKLDDRTdhrm-----vrkFLKEFGE-FPNFRENIAEFES---FIKQLMEhyeged 702  Vanderwaltozy...
XP_004197605  594 ---EVKQIQEYAFKLGEATR-YLATNKQSTRqn--------ftSLIDIPDgLPKGITNITEFDS---MIEQLGMfysskg 658  Pichia farino...
EAZ62994      572 ---QIQSIQEYAYSLGEGARkfder-------------saryfSLLDISStVPKFIEDVAEFDL---MIEQLSSfyeqkg 632  Scheffersomyc...
XP_008096987  644 iarpit-----------kqhlrhgetvsPLADIRDQLEELW-----SPADLPVRAQqsrnvvLAETAEAIARSLFGvaIl 707  Colletotrichu...
CCD26231      682 vtftdik---------gifqlllgeniaNLDLVYNKLLQCWvlaseD-----AKYL------TKEVLKNVIWASLRfsK- 740  Naumovozyma d...
Q6FVC9        731 liftnvi---------ktlnqiihedipTIDVFYNKLLQCWsivesNDLKKVADKV------TKEIVTLTVWNAIKctK- 794  [Candida] gla...
EJT41526      689 vaflefk---------kllrfflhedvpDLDIFYNKLLQCWvlvspQ-----AGLL------TKEIVKDIVWSLIRleE- 747  Saccharomyces...
XP_003682278  680 lvftkfd---------tisspilyekieDLEMLYNKLLQCWdlvtpD-----SEIL------TQGVIKHVIYSCLRlwK- 738  Torulaspora d...
CAR29481      703 ivltdfk---------tiskllikeetmNFDLFFSKLLQCWdivtpNSLSV-----------TRKVFDSILWSILRfyK- 761  Zygosaccharom...
XP_003685981  705 lkfsnlk---------silsfflhesvpSIDIFYNKLLQCWeiitsN-----SEVL------TRELVKTIVWGAIRfcN- 763  Tetrapisispor...
EDO18462      703 iiftdlk---------hmyksllhedidGLELLFNKLLQCWemitdH-----SEVL------TTKVIMSIIWTIISfcK- 761  Vanderwaltozy...
XP_004197605  659 itvfnlvpafk-edmldfigdtkkndrsELLSLFEALNEFYq---eLPANFAESNA------TKRTAIILYLSLLKlhLs 728  Pichia farino...
EAZ62994      633 itmsslvnrflqtssildsvevqesertHANDIFELLYKAYypgshSLRKYNSING------LIKLAILLTASLIKtkPr 706  Scheffersomyc...
XP_008096987  708 danlptpeagpptwvpepppqpssqqssqrssqrfslspakrgqlsssqrlslsptklsqplsqrislsptkrgqalgqr 787  Colletotrichu...
CCD26231          --------------------------------------------------------------------------------      Naumovozyma d...
Q6FVC9            --------------------------------------------------------------------------------      [Candida] gla...
EJT41526          --------------------------------------------------------------------------------      Saccharomyces...
XP_003682278      --------------------------------------------------------------------------------      Torulaspora d...
CAR29481          --------------------------------------------------------------------------------      Zygosaccharom...
XP_003685981      --------------------------------------------------------------------------------      Tetrapisispor...
EDO18462          --------------------------------------------------------------------------------      Vanderwaltozy...
XP_004197605  729 ke------------------------------------------------------------------------------ 730  Pichia farino...
EAZ62994      707 eis----------------------------------------------------------------------------- 709  Scheffersomyc...
XP_008096987  788 lsfsptkgarsqspyipfssipfpfpssgpfsqssaasptptpppppppstaLQRLSMLAEDLNTANApARQHPVLSYWP 867  Colletotrichu...
CCD26231      741 ----------------------------------------------------RSNYDTYETEIYRTLD-DSYRSVIDSWD 767  Naumovozyma d...
Q6FVC9        795 ----------------------------------------------------KSDIDELRSLNYGKLS-EEQKSIVDQWD 821  [Candida] gla...
EJT41526      748 ----------------------------------------------------PSLFEPIQKEITQSLS-KPYQDIIDSWD 774  Saccharomyces...
XP_003682278  739 ----------------------------------------------------PSLYKAKETQIFDSLS-KPYRNIIGMWD 765  Torulaspora d...
CAR29481      762 ----------------------------------------------------SANYDKIETELRESLT-EPYSEMISHWD 788  Zygosaccharom...
XP_003685981  764 ----------------------------------------------------KNCYQDKLHNSKDTLT-TQYQEIIDLWE 790  Tetrapisispor...
EDO18462      762 ----------------------------------------------------RSHFTELDEELTNRLK-EPYKEIIDTWD 788  Vanderwaltozy...
XP_004197605  731 --------------------------------------------------eeEIDYERLFNEEYDGAS-SEIKAVLNSWS 759  Pichia farino...
EAZ62994      710 -------------------------------------------------nqlRSEYEFVIKKASPK-----VSNLLGEWN 735  Scheffersomyc...
XP_008096987  868 -TTrgVGTDGYISSVLASSTK-HMNAI-----------------NERRQRAESRRRKRRSQlfgpsAAGASSQPYGTQDE 928  Colletotrichu...
CCD26231      768 nLSdlENEHEVNSSRSTLPLHsqpqfsfns-----qsqiptiksSQTRSQRSSIRPKSNRVnktksSNGFSASQDPRQFS 842  Naumovozyma d...
Q6FVC9        822 -LTddQLQDGLVDDGEASEQIrRPVQFsqyqesqs--qipviksSQTVRTRINSQRKSKTP------------------- 879  [Candida] gla...
EJT41526      775 -MDapEEEDESNEFNFNSQFSsTPFNgrsqfnlnsqsqiptiksSQNNGLTRRKRILKTQTqkvasTSQ----------- 842  Saccharomyces...
XP_003682278  766 -----DDDTDLIRPQTDTTSadysgilass-----qsqiptiksSQS-------RPAKKHRmvaagLTTGRVSKPSSNIS 828  Torulaspora d...
CAR29481      789 -----EDESQLMGDQTSDDRLiQESsrpqflfgs-qsqiptiksSQSKSTRRRRHPHSVQT------------ESSFNVP 850  Zygosaccharom...
XP_003685981  791 -LNddEIEEEANKLDNTESTApMsqphftres---qsqiptiklSQ--------RNERQERgiannANRISKSSRNRKSS 858  Tetrapisispor...
EDO18462      789 -MDesELDEELEKADLVNNQFfsqpqfslnt----etqiptirsSQ--------VSRNVNRgtsatTNRVSKISRSRIGT 855  Vanderwaltozy...
XP_004197605  760 -EAteStnesetpsssqfqe-----------slaimssmpsikiMSQMNDN----------------------------- 798  Pichia farino...
EAZ62994      736 -LDatNSSETMNFDSQVTQADimssl-------------psiriRSNHTSNNSKSKSLRQKaiknsQSQTP--------- 792  Scheffersomyc...
XP_008096987  929 ------WEDSGPATGPESAPLPSpttqplpklappiigssqappvvvPSSQTFFSSqmp-----qvMSQPV---LGRNAM 994  Colletotrichu...
CCD26231      843 q-------MSSQLTNSISSTLPDtmtpaf-------------tlmqpVSTLSAGSSgt------piGSQSRss----qRG 892  Naumovozyma d...
Q6FVC9        880 ---------SSQLAPSQASILPSsmspaf------------sldsqpPLLSQTFSQ----------SSQPKk-------- 920  [Candida] gla...
EJT41526      843 -------------STQNLSILPDsmtpaf-------------tlmqpPSSQISFVS----------DSQTRss----qRA 882  Saccharomyces...
XP_003682278  829 slrdtgSTFSMLSSSQPSNTLPDtmtpaf-------------tlmhpPSASL---------------SQSQss----qRS 876  Torulaspora d...
CAR29481      851 ftpteqDLSSSRISGSQWGLLPNtmtpaf-------------slmssPTPML---------------SQSQns----qRP 898  Zygosaccharom...
XP_003685981  859 qa---rPLCSQAFSSSQTSILPDnitpaf-------------slmqaSAPSL---------------SQSQssqTSKNKK 907  Tetrapisispor...
EDO18462      856 qnrlerPVSSFL--SSQPSTLPDtmtpaf-------------tlmqsNVPTL---------------SQSQgtqLSQ-RS 904  Vanderwaltozy...
XP_004197605  799 ---------TNVASSQRGSELPSsqidep------------slrfqtSNSQNTVSRlnsqqtqrslASQTGsssQKR--- 854  Pichia farino...
EAZ62994      793 ---------SNLAQFSQLTQLPQpnnlvsmsqylpsedllfstpesfPSSQTMTPS----------LSQKRs--LGSQGN 851  Scheffersomyc...
XP_008096987  995 RSpgKKKKRKSGF 1007 Colletotrichum graminicola M1.001
CCD26231      893 K---KKKKKVGGF 902  Naumovozyma dairenensis CBS 421
Q6FVC9        921 ----RKKKRMGGF 929  [Candida] glabrata
EJT41526      883 R---KKKKRIRGF 892  Saccharomyces kudriavzevii IFO 1802
XP_003682278  877 R---RKKKRVGGF 886  Torulaspora delbrueckii
CAR29481      899 R---RKKKRIGGF 908  Zygosaccharomyces rouxii
XP_003685981  908 K---KKKKKIGGF 917  Tetrapisispora phaffii CBS 4417
EDO18462      905 K---KKKKRVGGF 914  Vanderwaltozyma polyspora DSM 70294
XP_004197605  855 ----MKKKRKRGF 863  Pichia farinosa CBS 7064
EAZ62994      852 KP--KKKKRKGGF 862  Scheffersomyces stipitis CBS 6054
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap