Conserved Protein Domain Family
TTKRSYEDQ

?
pfam10212: TTKRSYEDQ 
Predicted coiled-coil domain-containing protein
This is the C-terminal 500 amino acids of a family of proteins with a predicted coiled-coil domain conserved from nematodes to humans. It carries a characteristic TTKRSYEDQ sequence-motif. The function is not known.
Statistics
?
PSSM-Id: 402010
View PSSM: pfam10212
Aligned: 8 rows
Threshold Bit Score: 775.151
Threshold Setting Gi: 156221626
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
XP_015218735 255 VAGQALGFVQDLVAALLNFHTYTEQRVHIYPRDSAI-EPISPLNQKFSQYLHENAGYVRPLEDGLQQLLESITEETITTL 333 spotted gar
XP_005999342 254 ITGQALTFLRDLVAALLNFHTYTEQRVQIFPIDTAI-DTISPLNQKFSQYLHENASYVRPMEEGMLHLFESITEDTVTTL 332 coelacanth
XP_002935419 254 LASQGLSFVRDLVTALLNFHTYTEQRVQIFPIDSAI-DVISPLNKKFSEYLHENASYVRPLEDGMLQLFESVTEDTVTVL 332 tropical clawed...
XP_015133550 238 LAGQALSFVQEIVTALLNFHTYTEQKVQIFPIDSAT-DTISPLNQKFSQYLHENALYVRPLEEGMLQLFESITEDTVTVL 316 chicken
Q3TDD9       255 IAGQALAFVQDLVPALLNFHTYTEQRIQIFPVDSAI-DTISPLNQKFSQYLHENASYVRPLEEGMLHLFESITEDTVTVL 333 house mouse
EEN53247     255 I-GQALGYIGDLVSGMSNYLTYAEQRSQIFPMDSSTgEPLSPVNRRLCQYLHENASHLRPIEQSFRSFHEGLREDALTTL 333 Florida lancelet
EDO42479     246 LTALANDLIKELMSALSNLHTYTEQRIKTFYVESEQ-MQLTASTQKFCGYLHENAAVLRAVEQSFSSFHKNLKTDSLITL 324 starlet sea ane...
CAG09468     309 VAGQALSFIQDLVAALLNFHSYTEQRVHIYPRDSSI-EPISALNQKFSQYLHENAAYVRPLEESFLQLHQSITEDTVTVL 387 spotted green p...
XP_015218735 334 ETTVKLKDFSDHFTSYTRFLQKILPYQLKSLEEECESPLCTSSLTSKNKELQDDMRKMTSVFEKLQNYISLLSLPSTKPE 413 spotted gar
XP_005999342 333 ETAVKLKEFSHHLISYTCFLKKILPYQLKSLEEECMSSLCTSTLRARNMELYSDMKKMTAAFEKLQTYISLLALPSTKPE 412 coelacanth
XP_002935419 333 ETAVKLKIFSENFASYVCFLQKILPYQLKSLEEESEFSSCTSALLARNVELHNDMKKITAAFDKLKTYITLLALPSTKPE 412 tropical clawed...
XP_015133550 317 ETAVKLKAFSEHLASYLCFLRKILPYQLKSLEEECESSLCTAALKARNMELHRDMKRLTAIFEKLHTYVSLLALPSTKPE 396 chicken
Q3TDD9       334 ETTVKLKMFSDHLTSYVRFLRKILPYQLKSLEEECESSLCTPALRARNLELSQDMKTMTAVFEKLQTYVTLLALPSTEPD 413 house mouse
EEN53247     334 ETATGIQDFSEKFHSFVAYMEKLLPYQLRSLEEECAVSTCSATLEARNMELHASLPKLTATLSKLDNYLSLIAAASKSSR 413 Florida lancelet
EDO42479     325 ETVVGLKHFADAFHDYVNYLKKILPYHKLSMEEDCNSSTCSTTLQGHNHQVFNSLVHFFQVFNKIDSYVSALASASNLPG 404 starlet sea ane...
CAG09468     388 ETVVKLKSFADHFSSYVQFLKKILPYQLKSLEEECETPLCTAALTAKNQELQSDVKKVTSLFEKLQNFINILALPSVCQD 467 spotted green p...
XP_015218735 414 ALPPSSFSAVFTQLAACLHGLQDAMKDVSKHYSQKATLEQDLPTVTQKLRTTNECILSSLGSLTNSTGKIATFFSNNLDF 493 spotted gar
XP_005999342 413 ALPQMNFSAVCTQLAACLHGLYDVMKDISKHFNQKITLEQELPTVTQKLKTTNDCILSSVVTLANVTGKIATYFSNNLDF 492 coelacanth
XP_002935419 413 GLLRSNYGTILTQISEALHRLHDITKELSKHYNNKAALEQELPAATDKLKTTNDCILSSLAALTNVTSKIATFFGNNLDY 492 tropical clawed...
XP_015133550 397 GLLRTNYSLVFTNIAASLHGSHDILKDISKHYSQKATLEQDVPTATQKLVTTNDCILSSILSLTNGVGKIASFFSNNLDH 476 chicken
Q3TDD9       414 GLLRTNYTSVLTNVGAALHGFHDVMKDISKHYSQKASIEHEIPTATQKLVTTNDCILSSAVTLTNGAGKIASFFGNNVDY 493 house mouse
EEN53247     414 EHPRTNQAAFFTQMAAGLNQLHEVLKEISKHYNTKVSLEHQLPTATQKLKTTDECVVSSLVALVSCTGKLAPFFSSHLEF 493 Florida lancelet
EDO42479     405 LLP-VNYSVSFMQLTCFLEELNDAVKELSKHYHSKISIEHQLPTTSQTLKTTDECIMSTFVYLITTTGKIVKFMNNNLDF 483 starlet sea ane...
CAG09468     468 VVPQSSTSTVFTQLAGCLHSLDDAVKEMSKHYNQKAVLEQELPTVTQKLLTTSECLLASLGSLSSSTGKIATFFSNNLDF 547 spotted green p...
XP_015218735 494 FTASAGYGPRGGL---GLLNPLQAECMLQNKRRAAAYILRLRKPRPESVPYLEALSNRRVLTSSTESREGLTQQVQQSQE 570 spotted gar
XP_005999342 493 FTTSSGYGPKGGK---EVMNPLSVECMLQYKKKAVAYIASVKPPQLESVPYEEALSNRRVLLSSTESREGLAQQVQQSQE 569 coelacanth
XP_002935419 493 FISSLSYGPKGGQ---GFTNPVSAEMMLEYKKKAAQYMNSLKKPCPDSVPYEEALMNRRVLLSSTESREGLAQQVQQSLE 569 tropical clawed...
XP_015133550 477 FTSSLSYGPKGGT---EFISPLSAECMLQYKKKAVAYMKSLKKPCADSVPYEEALANRRVLLSSTESREGLAQQVQQSLE 553 chicken
Q3TDD9       494 FIASLSYGPKTAS---GFISPLSAECMLQYKKKAAAYMKSLRTPLAESVPYGEAVANRRVLLSSTESREGLAQQVQQSLE 570 house mouse
EEN53247     494 FVSRAGYRTRGVSlcrDTDGPVSSPVVTDLRDRATSYVSRLKRPCPESVPYKTAVLNRRTLLSSTESREGLAQQLTTAQE 573 Florida lancelet
EDO42479     484 LTSKSVLRTRGATt-aTEADLTTSPIVISFRHQAVDYLSKIKAPCPESVPYSLAVHNNKVLAHSSQSKDTLSEQITQNQE 562 starlet sea ane...
CAG09468     548 FT-SAAYSPKGST---VALSPLQAESMLANKKKASAYIHTIKKPRPQSVPYSEALSNRRILTSSTESREGLTQQVQQSLE 623 spotted green p...
XP_015218735 571 KIARLEQEKEHWLLEAQLSRIKLEKETQRIADLERQLsmaLAGQP----PSAAQSSPAAPRPGQEGAESVECDPKEPVPT 646 spotted gar
XP_005999342 570 KIAKLEQEKEHWMLEAQLAKIKLQKENQRIAELDTQLkhaLGGQT----TTLESMKEHAVTHNKTGGEVDGKDLKEPFRS 645 coelacanth
XP_002935419 570 KIGKLEQEKEHWMLEAQLSKIKLEKETHRIAAL-------IKSTEmgqlAEVPHDNAFFLLNAGEHGKANSTETK----S 638 tropical clawed...
XP_015133550 554 KIAKLEQEKEHWMLEAQLAKIKLEKENQK-----------LKNSLsghlAETVQERSVLSNTAEQKEETTEKSQREPIKT 622 chicken
Q3TDD9       571 KISKLEQEKEHWMLEAQLAKIKLEKENQRIADR-------LRGTTsaqlPGLAQENATVPIASSQ-EEAAAKVLTEPVQS 642 house mouse
EEN53247     574 KMRGLEQEKEHWMLEAQLLQVRLEKETKCVE----------KGFNkgyvRQSVQTKRTIELTASMDSKPVRILMFFPYRA 643 Florida lancelet
EDO42479     563 RMSKLEQAKEHWMLEAQLLQVKFEKESKRAELLEKEV------HKlklmPKLHESEDI-----KQPSSFSSISERPPTPP 631 starlet sea ane...
CAG09468     624 KIARLEQEKEHWLLEAQLGKVRLEKENQRIADLEAQLaaaLGGSS----AAPSAAAGTLTQSHEETEAESRAAEKESTLC 699 spotted green p...
XP_015218735 647 TSLVGMLTTTqISEEAGDEQSREQLIKSHYMSRVADLTAQLQVADSKAVHFHAECRALAKRLALAEKSRETMTEEVKMAN 726 spotted gar
XP_005999342 646 TSLIGMLTVI-NSEEVPDGEFREDLIKNHYMTRVAELTSQLQVADSKAVHFYAECRALAKRLSLAEKSREVLTEEIKLAN 724 coelacanth
XP_002935419 639 TSLIGMLTGTtEDLQSQDCDSTEELIKNHYMARIAELTTHLQQADSKSVHLYAECRALAKRLALADKSNRSLTEETKSAV 718 tropical clawed...
XP_015133550 623 TSLIGMLTITtDNEKVPDVESREDLIKKHYMARIAELTSHLQLADSKSVHFHAECRALAKRLSLAEKSKESLTEELKLAS 702 chicken
Q3TDD9       643 TSLVGMLTRTpDSE-APDVESREDLIKSHYMARIAELTSQLQLADSKSVHFYAECRALSKRLALAEKSKETLTEEMRLAS 721 house mouse
EEN53247     644 SGFLKTLMSYlGRENSSESETREQLIKAHFTGRVTELTTQLQQADSKAVNFHSECRALQQRLGLAEKAKEKFQEELQTAQ 723 Florida lancelet
EDO42479     632 TDLGEVLTVT---DETSEEQTRENLIKSHFTSRITELSSQLQLVDGKAASFGTECRSLYKRIKQADKNKSDLSMELQVAK 708 starlet sea ane...
CAG09468     700 TSL------------LGDEESREQLIKTHYMARVGELTTQLQISDSKAVHFHSECRALAKRLAIAEKSRESLSEDVKLAN 767 spotted green p...
XP_015218735 727 QNISRLQDELTTTKRSYEDQLSMMSDHLCSMNETLSKQREEIDTLK-LGSK 776 spotted gar
XP_005999342 725 QNITRLQDELTTTKRSYEDQLSMMSDHLCSMNDTLSKQREEIDTLK-MSSK 774 coelacanth
XP_002935419 719 QSISKLQDELITTKRSYEDQLSMMSDHLCIMNETLSKQREEIDTLK-MATK 768 tropical clawed frog
XP_015133550 703 QSISRLQDELMTTKRSYEDQLSMMSDHLCSMNETLTKQREEIDTLK-MTSK 752 chicken
Q3TDD9       722 QNISRLQDELMTTKRSYEDQLSMMSDHLCSMNETLSKQREEIDTLK-MASK 771 house mouse
EEN53247     724 QKIAQLQDELTTTTSNYESQLSMMSEHLCSMNDKLTQQRDEIDALK-LSNK 773 Florida lancelet
EDO42479     709 GRVKEIQDELEVTKRNYETQLSMMSEHLCGMNEKLTTQQDEIEALKgRATK 759 starlet sea anemone
CAG09468     768 QNVTRLQDELATTKRSYEDQLSMMSDHLCSMNETLTKQREEIDTLK-LGSK 817 spotted green pufferfish
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap