5LJ3


Conserved Protein Domain Family
Cir_N

?
pfam10197: Cir_N 
Click on image for an interactive view with Cn3D
N-terminal domain of CBF1 interacting co-repressor CIR
This is a 45 residue conserved region at the N-terminal end of a family of proteins referred to as CIRs (CBF1-interacting co-repressors). CBF1 (centromere-binding factor 1) acts as a transcription factor that causes repression by binding specifically to GTGGGAA motifs in responsive promoters, and it requires CIR as a co-repressor. CIR binds to histone deacetylase and to SAP30 and serves as a linker between CBF1 and the histone deacetylase complex.
Statistics
?
PSSM-Id: 402000
View PSSM: pfam10197
Aligned: 124 rows
Threshold Bit Score: 26.9913
Threshold Setting Gi: 380495996
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
5LJ3_F        11 SWNPKLMKNRKKVWETEQDLITEQQKLNTRLKEIEKE 47  baker's yeast
4_pfamImport   1 SWHPANKANQKHIWMAEQEAIKRREREQDKVKEVRK- 36 
XP_002897409  10 SWHPANKANQKRIWVAEQQAKAREERERQKAKEVRKa 46  Phytophthora infestans T30-4
EFC43478      10 SFHPLNKQNQRKKWIAEQQEKAKRKLAEQRIKELADE 46  Naegleria gruberi
EDQ72636      28 pWHPLSYPNQRRKWIAEQQNAQKERKAEEVAHEFAQq 64  Physcomitrella patens
ERM94763      39 pWHPLSYPNQRRKWIAEQTDAQHHRRAQEVAREFAQE 75  Amborella trichopoda
EFA83589      11 SFHPGTKENQKKLFIAEQKASANEKRERERAKERQDE 47  Heterostelium album PN500
XP_004360442  10 SFHPTNKVNQKKLFIAEERSKTDRKKEEERSKQVIEE 46  Cavenderia fasciculata
XP_003293681  10 SFHPGNKQNQKKLFLAEEKEKESKRKEEERAKEVLve 46  Dictyostelium purpureum
Q54QA7        10 SFHPGNKNSQKKLFIAEEREKQLNKRENERAKEVLTE 46  Dictyostelium discoideum AX4
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap