Conserved Protein Domain Family
Phospho_p8

?
pfam10195: Phospho_p8 
DNA-binding nuclear phosphoprotein p8
P8 is a short 80-82 amino acid protein that is conserved from nematodes to humans. It carries at least one protein kinase C domain suggesting a possible role in signal transduction and it is thought to be a phosphoprotein, but the sites of phosphorylation and the kinases involved remain to be determined.
Statistics
?
PSSM-Id: 401999
View PSSM: pfam10195
Aligned: 26 rows
Threshold Bit Score: 52.3029
Threshold Setting Gi: 307768435
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
XP_002434896   3 ESHFDEYEH-YNFDqDKFIFAGHSGKQRTKREVSEHTNHHDPNGHVRKLVTKMVNTERNR 61  black-legged tick
P34654         6 EEMAAAFEQtGGPD-----LTTGSGK-RTKSDRVEHKHASQPGGDTRKVVQTASNGEAKR 59  Caenorhabditis elegans
EDO30054       2 EPYFDEYDY-YNFD-RNVVEG-NTRKGRSKREACLNTNRFCPGGHERKVLEKYRNTEKNR 58  starlet sea anemone
6_pfamImport   1 EDYLALDEM-YNLD-HLLRGG-GARKGRSKKEAAIHTNRPSPGGHERKLLTKLQNTEKKK 57 
XP_005323865  22 EASLDEYDL-YGLA-HPHVAG-GGRKGRTKREAAAHTNRPSPGGHERKLVTKFQNSERKK 78  thirteen-lined ground squirrel
XP_002927412  21 DPSLDEYDL-YSLA-HSYLGV-GGRKGRTKREAAAHTNRPSPGGHERKLVTKLQNTERKR 77  giant panda
EDO38759       2 ESHLDEYDY-YNFE-TSLSGANSSRKGRTKRETGMNTNRPCPAGHERKLSTRLQNAERKK 59  starlet sea anemone
XP_001363260  58 EEHYDCYDY-YNLR-EYPIRGPGWSKGRTRRERELRTNRPVPAGHERKIAQKLYNSQRKR 115 gray short-tailed opossum
XP_006640899  13 EEHYDQYEY-YNLI---EFSCHAGGKGRTKREIGLHTNRHCPAGHERKIAEKFHNSELKR 68  spotted gar
XP_001368778  21 qqfLDQYDT-YNFT-DSYLGR-GSGKGRSKREAANHTNRHSPGGHERKLLIKLQNTEQKK 77  gray short-tailed opossum
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap