Conserved Protein Domain Family
GpcrRhopsn4

?
pfam10192: GpcrRhopsn4 
Rhodopsin-like GPCR transmembrane domain
This region of 270 amino acids is the seven transmembrane alpha-helical domains included within five GPCRRHODOPSN4 motifs of a G-protein-coupled-receptor (GPCR) protein, conserved from nematodes to humans. GPCRs are integral membrane receptors whose intracellular actions are mediated by signalling pathways involving G proteins and downstream secondary messengers.
Statistics
?
PSSM-Id: 401997
View PSSM: pfam10192
Aligned: 22 rows
Threshold Bit Score: 166.269
Threshold Setting Gi: 124466831
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
AAH83689      40 EEDIPFEMVLLNPDaeg-------npLDHFSARESGLHEFFFLLVLVYFVTACIYAQSLwQAMRKGGPMHTILKVLTTAL 112 Norway rat
XP_002643928 183 NVPINYDIWLTNGRpnsaa---vsffTFNFSFDEQNTVQLFLLTVCMYAILSIIQS----GANFKNRQIPPRSIILSRII 255 Caenorhabditis ...
Q9W2B3       282 LNTLHYDIHLVNLHpnnsa---ahplTYQYSYDQQNLLEMYLVFLLVYIVLLPM------QIYAVRRQKHPVTKLFTVSL 352 fruit fly
Q7PZ34       178 PPAINYDITLVNGNpnrqtlsffnplLFHFSFDQQNTLEMYLIFFVVYLLMVPL------QIYAVRLQKHPVTRLFTVSL 251 Anopheles gambi...
Q8NBT3       143 GLQLEYEMVLTNGKsf---------wTRHFSADEFGILETDVTFLLIFILIFFLSCYFG-YLLKGRQLLHTTYKMFMAAA 212 human
EDO35662     108 VLDMDYKITVTNGdd----------wQSHLSADETHMLEIVSSFFLIMILTLIVGLVFA-KTLWIEHMLHRPYEIFLVSL 176 starlet sea ane...
Q7Q027       125 GLDVKYRFRMTNGPpgd-------fwHEHFSADEMYIPPILLAESIAYSFLLLAVFICA-VELKARHLYHCTYRLFTLSV 196 Anopheles gambi...
EDO35391       1 GLKLKYELNLTNGDdf---------wTMHFSADERHILKMDIFFVVTFLIVIVLAIHVT-YVLISRRLFHYTYKLFIWSL 70  starlet sea ane...
Q54MH1       156 KYFAEYVFSLSNNGdh---------iDSVLSADQQSIPQSQMFYFLLYIIMFVITIVFI-IILKKKQLESKVLQFFIVIL 225 Dictyostelium d...
Q54YJ2       143 PFVSTYTFEVQNSGds---------fDSQLSAEQQSIPQGQIFFFLLYTAFLIISIIYS-VALKKKGLEGKAIHFFIAIL 212 Dictyostelium d...
AAH83689     113 LLQAASALANYIHFSRYS-RDGIGLPLMGSLAEVFDIASQIQMLYLLLSLCMGWTIVR-MKKSqsrplqwdSTPASTGMA 190 Norway rat
XP_002643928 256 TMKLIGYSLQCFNVLLFA-YDGQGFFIARIAGEVLRNTSVQVHCLLLILLAKGWDISY-PGTE--------YPRRTIIMW 325 Caenorhabditis ...
Q9W2B3       353 LSEFVSLALITAHLIHYA-ANGVGEPRLQAAGDVLDILSRTTFMLILLLLAKGWAVTR-QQISr------tGWIILMSIW 424 fruit fly
Q7PZ34       252 VLEFVSVCLLLTHTVRYA-MNGVGDEKLAIMGDIFDIFSRTSFMLILLLLAKGWAVTR-LQISv------sSWILLMVIW 323 Anopheles gambi...
Q8NBT3       213 GVEVLSLLFFCIYWGQYA-TDGIGNESVKILAKLLFSSSFLIFLLMLILLGKGFTVTR-GRISh------aGSVKLSVYM 284 human
EDO35662     177 GYELFGLLLSVVYYIEYV-SYGTLRTPIHTTSGLLHAVSEIIFVCLLILLSKGYTITR-ARLSs------rGQIKLSVFI 248 starlet sea ane...
Q7Q027       197 LLQWFGILLLSVTWTKYA-VSGIG--PFPNFGGIFTSASEISFLLLLLLMAKGYTITR-ARLKt------cSTVKITIFI 266 Anopheles gambi...
EDO35391      71 LLEFVSICVNIGYYVHYG-NTGFAVYSAQIAARAIHYIAHIMFLVLLILLAKGWTVTSlFSITs------aSSVLLYKYG 143 starlet sea ane...
Q54MH1       226 GVQLISLVLFLANWSTIIkYDGPELKYANLFGNIFSILANSLFVLLILMVGQGWTTSL-YYGSm------iKRMVNLSVS 298 Dictyostelium d...
Q54YJ2       213 LIFLISLALYISNWAHILkYHKYELRYLNLFGNIFEILGNGLFVALILMIGQGWTTSI-YFGSl------vKQMINILVS 285 Dictyostelium d...
AAH83689     191 AFIVITQSVLLLW-EQFEDTSHHSSHSHLSLAGVLLIILRICLALSLGCGLYQ-IITMERSTLKREFYITFAKGCILWFL 268 Norway rat
XP_002643928 326 GILAGLDTILFFYnCTFVYDVLHDVDIYSAWPGHGMILIRIVYAIWFLIEIRK-LIDSEQNRHKAEFLAHFGAGFLVWFV 404 Caenorhabditis ...
Q9W2B3       425 VPYCAFHVFLYIW-DRTEVDVVSDIDEYQTWPGWIVLILRTSFMMWFLYELRN-TMKYEHSTKKLDFLLHLGASSLVWFI 502 fruit fly
Q7PZ34       324 IPYCAIHVLLYIW-NRTEVDIISDIDEYQTWPGWLVLACRSTMMLWFLWELRT-TMKYEHSSQKLDFLLHFGASSLVWFI 401 Anopheles gambi...
Q8NBT3       285 TLYTLTHVVLLIYeAE-FFDPGQVLYTYESPAGYGLIGLQVAAYVWFCYAVLV-SL--RHFPEKQPFYVPFFAAYTLWFF 360 human
EDO35662     249 GLYSVTFSILFFIqAN-MFDPGLVKYLYDSAAGTGIVALRIVAWCWFSLSVHH-TV--KRYPEKRVFYGWFFVLFSVWFL 324 starlet sea ane...
Q7Q027       267 NLYVVVYVSLYIYqAE-AFDPGEVLNLYESPAGFGLAGLRCAGWIFFMYACAA-TI--RKFAEKTPFYYPFTMLGSLWIL 342 Anopheles gambi...
EDO35391     144 TNGCCTYQLLVLLkGKHIFDPADVLYVYESPAGIGICILRVIAWLWFCYGPFIfTL--KHFPSKATFYYPFWFFYTGWFL 221 starlet sea ane...
Q54MH1       299 GLLFVFGVIVYIFvCFKAPEFNNYIYFYDTYPGYALLAIYVFIIFFFTIGNTL-SRRKQNDEMKKKFILIFTIIFTLWFI 377 Dictyostelium d...
Q54YJ2       286 IALIVIGWVAYVYyVYHSKEQNSYIYFMDTCPGYFLLALYVVIIGYFCWANYV-NRNKQNESIKKNFILIFTIIFVFWLI 364 Dictyostelium d...
AAH83689     269 CQPALACIAVF-FNDYQRDKVITVGVILCQAVAMVIL 304 Norway rat
XP_002643928 405 SLPMIGIVASF-VSQLWRFSLILALTTFANFVALSCL 440 Caenorhabditis briggsae
Q9W2B3       503 YLPIVAIVALQ-VSPMWRYKLLQGITNSADCMAYCVM 538 fruit fly
Q7PZ34       402 YLPIVAIIAVN-VSPLWRYKLLLGITNSADCLAYCVM 437 Anopheles gambiae str. PEST
Q8NBT3       361 AVPVMALIANFgIPKWAREKIVNGIQLGIHLYAHGVF 397 human
EDO35662     325 AKPSLVLLGYYhIEEWERTKIFSGVDFAISAIGFLVF 361 starlet sea anemone
Q7Q027       343 SGPVLTLLGVSvLDPWVRESVMHGALGAVAFAGHLAF 379 Anopheles gambiae str. PEST
EDO35391     222 AGPVIVLISAYvIQKWARSQIVHGIEWSVSLLAHVFF 258 starlet sea anemone
Q54MH1       378 AQPMIVVCAHF-TEPWVKFKVISILYQTINAIFYIVL 413 Dictyostelium discoideum AX4
Q54YJ2       365 SHPLVVIVAHF-MDPWVKYKVIALLNLTINAIFFIIL 400 Dictyostelium discoideum AX4
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap