4OWW


Conserved Protein Domain Family
Ints3

?
pfam10189: Ints3 
Integrator complex subunit 3
The Integrator complex is involved in small nuclear RNA (snRNA) U1 and U2 transcription, and in their 3'-box- dependent processing. This complex associates with the C- terminal domain of RNA polymerase II largest subunit and is recruited to the U1 and U2 snRNAs genes. This entry represents subunit 3 of this complex.
Statistics
?
PSSM-Id: 401995
View PSSM: pfam10189
Aligned: 33 rows
Threshold Bit Score: 261.762
Threshold Setting Gi: 341883160
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
4OWW_A        270 LWKDIIHNPQALspq-ftGILQLLQSRTSRKFLA-CRLTPDMETKLLFMTSRVrfgqqKR----YQDWFQRQYLSTPDSQ 343 
O23315        224 IWNDLVSN----------HCSEIYQLKTSSRYFL-LRITPEMETQLRFLLGNVklgshKR----HQIWFLKKFLLGPEKE 288  thale cress
XP_009132998  235 IWNDLVCS----------DVSKIYQLKTSSRYFL-LRITPEMETQLRFLLGNVklgshKR----HQIWFLKKFLLGPEKE 299  field mustard
XP_006663247   57 LWKESVLG----------RVADICRIGTPGWSTA-LAISPEMETQLLFMMNNVkwgnqKR----YQLWFAKKHLMVPGGE 121  malo sina
XP_009416912  234 LWKDLLSDPKKLgvaefsDLSDLYRIRTPTHYFL-LRIPPEMESQLRFLLTYVrwgnqRR----YQAWFAKKHLCWPGSE 308  wild Malaysia...
EGT39095      249 IWKDIATNPASY------GVAGIEDFLSKPHVLQhLRLSIELDRKLQFMVNNG-----GKnmliYFSWFSNKYLRGADGP 317  Caenorhabditi...
XP_003111147  250 IWKDILTNPASY------GVASIEDYWGKNHYLQhVRISIELERKIIFMIHSG-----GKnlliYFSWFANKYFRGNDGP 318  Caenorhabditi...
KJE89155      347 LWTDLIHRPTTLnah-fpGVKQILRTDTRARFLV-GRTTLDLESKLRFLLTTVkhgelRR----YYQWFAKKYLEAPESE 420  Capsaspora ow...
XP_006676969  235 LLLSIMQSPSPEypn-ipSLSDFLDRPTPREFLI-SRLTPDMEIRIVFILNSVp----KRlsftFIEQFRKRFL-TLESE 307  Batrachochytr...
EPB87097      245 IWDDVVNHPQKLspk-fgGIQTMLNSPTPRDFLK-CRLTPDIEHKLLFILQNLrithfQK----NLNWFTQRFLSAPESE 318  Mucor circine...
4OWW_A        344 SLRCDLIRYICGVVHPSNEVLSSDILPRWAIIGWLLTTCTSN-VAASNAKLALFYDWLFFSPDK-DSIMNIEPAILVMHH 421 
O23315        289 TLLIDIVRFVCCVIHPTNEIIRSEIMPRWAIIGWLLELCRQNhHIERSVMLALFYDWLFFDERI-DNIMNVEPAALLMVW 367  thale cress
XP_009132998  300 TVLIDIVRFICCVVHPTNEIIRSEIMPRWAVIGWFLDLCKQNhHVEGRVKLALFYDWLFFDERI-DSIMNVEPAVLLMLW 378  field mustard
XP_006663247  122 ERIPDIVRFICCGYHPSNEVMQSGVIARWAVIGWLLTRCSKS-YVQANAKLALFYDWLFFDEGK-GNVMNIEPAMLLMVN 199  malo sina
XP_009416912  309 TVISDIVRFICCAHHPSNEIIQSNVISRWAVIGWLLKCCRRN-HFEANVKLALFYDWLFFDDRV-DSIMNIEPAMLLMVN 386  wild Malaysia...
EGT39095      318 ALRAECVRQLLYMAPDQKQ--PGSYDNRIQIIHLLVTTAQPV-AEQQWLKLCLFADWFGCDEKNiTNFGYVETPFLVLRY 394  Caenorhabditi...
XP_003111147  319 ALRAECVRHVLYLQLDVAKAPPSAFENRIQLLHLIVSTAPSG-PEQQWLKLCLFADWFGCDERNpSNFTYVEIPLSVVRY 397  Caenorhabditi...
KJE89155      421 AMLPDLIRYVCCAYHPTNEVLASDVAPRWMTISWLMWRAKSP-TAMADVRLALFYDWMFFDPAR-SNIMNIEPGILLIQH 498  Capsaspora ow...
XP_006676969  308 TLLPDIIRYICGAIHPNNAILASDIVQRWHLISILLRGIKAP-ACAQSCKLSLYFDWLFFNHAS-DSVMSLEPGILVMVK 385  Batrachochytr...
EPB87097      319 PFYVDVVRYLVAGWYPSNQILQSDIVPRYVVIGSMIRSIKSN-IVAANVRTALIFDWLFFKPT--DNIMFIEPAMLLMER 395  Mucor circine...
4OWW_A        422 SM--------------KPHPA-ITATLLDFMCRIIPNFYPPLEGHVRQGVFSSLNHIvEKRVLAHLAPLFDNPKLDKELR 486 
O23315        368 SI--------------PQYPH-ITHSLLEFLLHLVETYDITRRDTIVRGLTSAFREIeRKGVIRSLDIFLANPALAPDLK 432  thale cress
XP_009132998  379 SI--------------PQYPH-ITHSLLEFLLHLVDTYDIACRDMIMRGVASAFREIeRKGVVQSLDMFLSNPEIATDLK 443  field mustard
XP_006663247  200 SV--------------SQYTD-ITNMLLEFLFLLVENYEVQRKEAIGACVRNAFGVLvKKGVVPSLEILTCCEKLSPMLR 264  malo sina
XP_009416912  387 SV--------------PKYVD-IAHMLLEFLFLLVDNYDVDRRVLLARGVTASCRLLlRKGVVHSMEPLTSCDLLSPMLR 451  wild Malaysia...
EGT39095      395 ALflptmpshpntivqNSHGAqFANSLFEYICKSVDVFIPHLSGYVRKNVNNAMRCC-RDRLPHIFPQVMENTKIDRKIV 473  Caenorhabditi...
XP_003111147  398 ALflspspphqnsivqSSHCShFANSLLEYLCKSVDVLFPSNVEYIRKNVNNAMRYC-RDRLQHNLAQILENSKIDRKVT 476  Caenorhabditi...
KJE89155      499 ML--------------NMNGT-FAASLLEFVCLIATEFVPSLSSSITTSLRAAFYTCvSKRVIPSLSAIVNHTSIDEPLR 563  Capsaspora ow...
XP_006676969  386 NL--------------QTSPA-ISATMLEFLALIADRFLPTLSAHIYHNLKLSMSIVvEKRVITSLSLILLSPQLDEFTK 450  Batrachochytr...
EPB87097      396 SA--------------ERYAH-ITASLMQFLKRSVDEYFPPMKDYMSQCVACGMRVMlSKGVIRSLLPIYRCPATDQVTR 460  Mucor circine...
4OWW_A        487 AMLREKFP 494 
O23315        433 KKLANLls 440  thale cress
XP_009132998  444 KKLANLls 451  field mustard
XP_006663247  265 QKLVAFLs 272  malo sina
XP_009416912  452 EKLRSFLp 459  wild Malaysian banana
EGT39095      474 DLLKTVFP 481  Caenorhabditis brenneri
XP_003111147  477 ELLRSLFP 484  Caenorhabditis remanei
KJE89155      564 DKFNTTFP 571  Capsaspora owczarzaki ATCC 30864
XP_006676969  451 ETVTKLFa 458  Batrachochytrium dendrobatidis JAM81
EPB87097      461 DYMQALFS 468  Mucor circinelloides f. circinelloides 1006PhL
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap