Conserved Protein Domain Family
Mesd

?
pfam10185: Mesd 
Chaperone for wingless signalling and trafficking of LDL receptor
Mesd is a family of highly conserved proteins found from nematodes to humans. The final C-terminal residues, KEDL, are the endoplasmic reticulum retention sequence as it is an ER protein specifically required for the intracellular trafficking of members of the low-density lipoprotein family of receptors (LDLRs). The N- and C-terminal sequences are predicted to adopt a random coil conformation, with the exception of an isolated predicted helix within the N-terminal region, The central folded domain flanked by natively unstructured regions is the necessary structure for facilitating maturation of LRP6 (Low-Density Lipoprotein Receptor-Related Protein 6 Maturation).
Statistics
?
PSSM-Id: 401992
View PSSM: pfam10185
Aligned: 14 rows
Threshold Bit Score: 240.048
Threshold Setting Gi: 512930617
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
XP_006628688  34 KKDIRDYNDADMARLLEEWEK-DDD-IEEGDLPEHKRSPPPVDFSKIDPSKPEELLKMTKKGRTLMVFATVSGSPTEKET 111 spotted gar
EEB15833      31 KKDIRDYNDADLERLLDQWEE-GEEpLEPDELPEHLRPQPSIDFSKLDTSNPENLLKLTKKGKTLMMFVSTTEDLSKDES 109 human body louse
EFX86776      37 KKDIRDYSEADLERLLDQWDE-DEEpLPNDELPEHLRKPPPIDFSKIDASDPENLLKVSKKGKTIMTFVQVAGDVTRNEA 115 common water flea
EKC20281      32 KKDIRDYSEADLERLYDQWEEnDDEeLPEDELPEWKREPPKVDLSQLDPNNPELMLQASKKGRTLMMFATVSGDPTEKET 111 Pacific oyster
Q9ERE7        43 KKDIRDYNDADMARLLEQWEK-DDD-IEEGDLPEHKRPSAPIDFSKLDPGKPESILKMTKKGKTLMMFVTVSGNPTEKET 120 house mouse
3_pfamImport   1 KKNILQYNDEDMEQLLKQWEK-DDV-LEEWELPQQRK---PLDTSQAAPGKPDSVLKMTKKGKTLIMFATVSGNPTKKET 75 
1_pfamImport   1 KKDITDFTEADMERLLDQWEE-DEEpLEPDELPEHLRPQPQLDLTKIKGSDPEDLLKLSKKGRTLMTFVVVDGNPTRDQS 79 
XP_004932103  29 KKDIRDFSDADMERLLDQWEE-DEEpLPEDELPEHLRKPPALDLTKMDMSNPEAVLQATKKGQTLMMFVSVANKPSRART 107 domestic silkworm
XP_001606770  39 gKDVRDMTDADLEHLLDQWEE-DDEpLEPDELPEHLRPQPKIDLSKMDLSSPDNLLKMSKKGKSIMMFVDVNPQLSENEA 117 jewel wasp
EFN77787      34 DKDIRDMTEADLEHLLDQWEE-NDEpLEPDELPEHLRPSPKIDLSKIDTTNPDNLLRVTKKGKGVMMFVDMRQDISEEQA 112 Jerdon's jumpin...
XP_006628688 112 EEITSLWQGSLFNANYDVQrfvvgsnRVIFMLRDGSYAWEVKDFLMSQDRCADVTVEGQVYPGKAAkkdgghkddkdlne 191 spotted gar
EEB15833     110 EKVTKLWQTSLWNNHIQVE-------RAIFMFKDGSLAWEAKNFLIEQESCKEVTIENKSYPGKHI-------------- 168 human body louse
EFX86776     116 DDMTKLWQSALWNNHIQAErfmvddnRAIFMFRDGSQAWEAKNFLIDQDRCFSVTIENKIYPGKGNp------------- 182 common water flea
EKC20281     112 EQITQLWQTSLFNANYEIQryvvgsnRVIFMIKDGSKAWEIKNFLVTQERCEEVTIEGKNYPGSAAk------------- 178 Pacific oyster
Q9ERE7       121 EEITSLWQGSLFNANYDVQrfivgsdRAIFMLRDGSYAWEIKDFLVSQDRCAEVTLEGQMYPGKGggskeknktkpeka- 199 house mouse
3_pfamImport  76 QEIGGLWQWSLFNANYNLQrvtvgtdVVIFMLPDGSKAWEIKEFLVNQDRCADVTLQGRVYPGKGGs------------- 142
1_pfamImport  80 ETITKLWQTSLWNNHIQAErymiednRALFLFKDGSQAWLAKDFLIEQERCKEVVIESKSYPGKFVs------------- 146
XP_004932103 108 EEITKIWQTSLWSNHIQAErylidddRAIFMFKDGSQAWTAKEFLLEQEELKEVQLESQTYPGKK--------------- 172 domestic silkworm
XP_001606770 118 DSILRIWQSSLQNNHIIAErypidqkRAIFMFRDGAQAVDAKNYLIEQPECSHVTLEGQNYVGKHAs------------- 184 jewel wasp
EFN77787     113 DVVMRIWQTSLQNNHIIAErypidtrRSIYMFRDGSQAVDAKNYLLEQPELSHLTLEGQTYY------------------ 174 Jerdon's jumpin...
XP_006628688 192 intekkkkkkredkkpgkENNKSSKKK 218 spotted gar
EEB15833     169 ------------------KKESQKLEK 177 human body louse
EFX86776     183 ------------------ENVKESSKE 191 common water flea
EKC20281     179 ------------------DKDADKSKQ 187 Pacific oyster
Q9ERE7       200 -----kkkegdpkpraskEDNRAGSRR 221 house mouse
3_pfamImport 143 -----------------kNQTKASVKK 152
1_pfamImport 147 ------------------KYSESERDK 155
XP_004932103 173 ------------------PDIKNKALR 181 domestic silkworm
XP_001606770 185 ------------------KEVKDklek 193 jewel wasp
EFN77787     175 ------------------RDSQQQAAV 183 Jerdon's jumping ant
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap