Conserved Protein Domain Family
DUF2371

?
pfam10177: DUF2371 
Uncharacterized conserved protein (DUF2371)
This is a family of proteins conserved from nematodes to humans. The function is not known.
Statistics
?
PSSM-Id: 401985
View PSSM: pfam10177
Aligned: 20 rows
Threshold Bit Score: 183.282
Threshold Setting Gi: 542248057
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
OCA33782      16 RQDSARSQHLLsrp-----tspPPDKKPV--------------RRRPRADVVIVRGKIRLYSPSGFFLILGVLISVAGIA 76  tropical clawed...
XP_015213874  16 RQDSARSQHHLplpt----pppPQEKKRV--------------KRKPRADVVVVRGKIRLYSPSGFFLILGIFISMVGIA 77  spotted gar
Q5RGQ8        16 RQDSTRSQYHLsaqs----pgpAPEKKTT--------------KRKPRADVVVVRGKIRLYSASGFFLVLGVLILMAGIA 77  zebrafish
5_pfamImport   1 RQDSARSQHRPpsaap-gpggsAPESAPR--------------KRKRRTDVVVVRGRLRLYSASGFFLLLGLVILAAGIA 65 
XP_005449742  16 RQDSARSQHRPvpptspglghaAPEAAPR--------------KRKRRTDVVVVRGRLRLYSASGFFLLLGLIILAIGIG 81  Nile tilapia
XP_003769479  16 RQDSARSQHHVnlsp----spaDQEKKPV--------------RRRPRADVVVVRGKIRLYSPSGFFLILGVLISIIGIA 77  Tasmanian devil
XP_008116308  16 RQDSARSQQHLnltt----spaNEEQKPV--------------KRRPRADVVVVRGKIRLYSPSGFFLVLGVLVSFLGIG 77  green anole
XP_005043612  16 RQDSARSQQHVnlag----vpvPEEKKPV--------------RRRPRTDVVIVRGKIRLYSPSGFFLVLGVLIAFFGIA 77  Collared flycat...
XP_023204087  16 RQDSARSQHRPippa---sqglANEGAPR--------------KRKRRTDVVVVRGRLRLYSASGFFLFLGLIILAVGIG 78  southern platyfish
AWP19853      16 RQDSARSQHRP--------------IPPTspglgnpvpeaaprKRKRRTDVVVVRGRLRLYSASGFFLLLGLVILAVGIG 81  turbot
OCA33782      77 MAVLGYWPQKEPFL---SSEV-------TVEVN-----RTKIL----------------------EEAGMMVKFFEQHLH 119 tropical clawed...
XP_015213874  78 MAVLGYWPHKDQVL---TPDS-------KLSTN-----DTQVIr---------------------DHGGIVAQFFEQHLH 121 spotted gar
Q5RGQ8        78 MAVLGYWPHKDQPK---APET-------KMSAN-----NTQSFg--------------------rEQAGSIAQFLEQHMH 122 zebrafish
5_pfamImport  66 MATLGYWPHRAPPAr-vTTCE-------VSERR-----STGTIs--------------------kRTAGALTRFLEQHRH 112
XP_005449742  82 MATLGYWPHSKAMLaggGTGVktekdaaNASHN-----GQGTPs--------------------rETESALMRFLEQHLH 136 Nile tilapia
XP_003769479  78 MAVLGYWPQKEHFI---DAET-------KLSTN-----QTQVIr---------------------NQGGIMVRFFEQHLH 121 Tasmanian devil
XP_008116308  78 MAILGYWPHKDLYA---ESED-------ILSLN-----ETQGIg---------------------KESGIIIRFLEQHLH 121 green anole
XP_005043612  78 MAILGYWPQKEQLL---GSEA-------NPSVN-----ETRTPr---------------------SQGSILLRFFEQHVH 121 Collared flycat...
XP_023204087  79 MATLGYWPHN--------------------KAV-----STGGGnevkvgkgvtnashdvqdspskQTGGALMRFLEQHLH 133 southern platyfish
AWP19853      82 MATLGYWPHSe----------------tMPSAKsatrgTSSKQ-----------------------TGGALTRFLDQHRH 122 turbot
OCA33782     120 SEKMKMLGPFTMGIGIFIFICANAILHENRDKETKVIHMR 159 tropical clawed frog
XP_015213874 122 SEKMKMLGPFTMGIGIFIFICANAILHENRDKETKVIHMR 161 spotted gar
Q5RGQ8       123 SEKMKMLGPFTMGIGIFIFICANAILHENRDRETKVIHMR 162 zebrafish
5_pfamImport 113 SERMKMFGPFTMGIGIFIFICANAILHENRDRETKIIHMR 152
XP_005449742 137 SERMKMLGPFTMGIGIFIFICANAILHENRDRETKIIHMR 176 Nile tilapia
XP_003769479 122 SDKMKMLGPFTMGIGIFIFICANAILHENRDKETKIIHMR 161 Tasmanian devil
XP_008116308 122 SDKMKMLGPFTMGIGIFIFICANAMLHENRDKETKIIHMR 161 green anole
XP_005043612 122 SDKMKMLGPFTMGIGIFIFICANAILHENRDKETKIIHMR 161 Collared flycatcher
XP_023204087 134 SERMKMLGPFTMGIGIFIFICANAILHENRDRETKIIHMR 173 southern platyfish
AWP19853     123 SERMKMFGPFTMGIGIFIFICANAILHENRDRETKIIHMR 162 turbot
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap