Conserved Protein Domain Family
Cast

?
pfam10174: Cast 
RIM-binding protein of the cytomatrix active zone
This is a family of proteins that form part of the CAZ (cytomatrix at the active zone) complex which is involved in determining the site of synaptic vesicle fusion. The C-terminus is a PDZ-binding motif that binds directly to RIM (a small G protein Rab-3A effector). The family also contains four coiled-coil domains.
Statistics
?
PSSM-Id: 401982
View PSSM: pfam10174
Aligned: 12 rows
Threshold Bit Score: 810.207
Threshold Setting Gi: 0
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q811U3        160 EVLRENDLLRKDVEV-KESKLSSSMNSIKTFWSPELKKERALRKDEASKITIWKEQYRvvqe--------enqH------ 224  Norway rat
9_pfamImport    1 QLQQDNESLRREIDI-KESKLQANMNSIKTFWSPELKKERALRKEESNQIATLKEQWK---------------H------ 58  
XP_009296283  166 EVLRENELLRKEIEV-KESKLSSSMSSIKSFWSPELKKERALRKDEASKISVWKEQYRavqd--------etqH------ 230  zebrafish
Q6PH08        156 ELQRENDLLRKELDI-KDSKLGSSMNSIKTFWSPELKKERVLRKEEAARMSVLKEQMRvshe--------enqH------ 220  house mouse
1_pfamImport    7 DLQRENDLLRKELDI-KDSKLGSSMNSIKTFWSPELKKERVLRKEEAARMSVLKEQMRvthe--------enqQ------ 71  
6_pfamImport    7 DLQRENNNLRRELEGgRDGRTGPSMNSV-NFWSPDLKREKGVRREEGVRSSIVKDQYRtnqe--------dlqQ------ 71  
8_pfamImport    7 ELQRENDNLRRELDTgRDARTGPSMNNV-NFWSPDVKRDRGVRREEAGRTSVLRDQYRtnqddlqpgdirrnkQ------ 79  
XP_022538566  156 DMQRENELLRRELDL-KESKLGSSANSIKSFWSPELKKERVMRKEEAARTSVLKEQMRvthe--------enqHmldarr 226  Mexican tetra
XP_023812415  222 DLRRENDSLRRELDGgRDGKTGHNMNSV-NFWSPEPKRDKGVRREEGLRPSAPKDHYRlsqe--------dsqH------ 286  Japanese medaka
XP_029317698  177 EVLRENELLGRELEA-KESKLSSSMNSIKTFWSPELKKERALRKDEATKMSLWKEQYRvvqe--------etqH------ 241  Cottoperca gobio
XP_031143341  162 DMQRENELLRRELDL-KDSKLGSSTNSIKSFWSPELKKERIMRKEEAARTSILKEQMRvtheenqlldarrtkH------ 234  pike-perch
XP_018670964   59 qLQQDLESLRREIDI-KESKLQSNMNSIKTFWSPELKKERALRKEERNQIVTLKEQLKvtqe--------enqH------ 123  vase tunicate
Q811U3        225 ---MQMTIQALQDELRIQRDLN---------------------------------------------------------- 243  Norway rat
9_pfamImport   59 ---LHLTMQALQDELRAQRDLN---------------------------------------------------------- 77  
XP_009296283  231 ---LQTTVQALQAELRIQRDLN---------------------------------------------------------- 249  zebrafish
Q6PH08        221 ---LQLTIQALQDELRTQRDLN---------------------------------------------------------- 239  house mouse
1_pfamImport   72 ---KEYQMNNIQDTKRTAIHINps-------------------------------------------------------- 92  
6_pfamImport   72 ---LPLTVQELQEELRAHREMN---------------------------------------------------------- 90  
8_pfamImport   80 ---LPLTVQELQEELKAHRDMN---------------------------------------------------------- 98  
XP_022538566  227 tkhLQMTIQALQDELRTQRDLN---------------------------------------------------------- 248  Mexican tetra
XP_023812415  287 ---LPLTVQELQEELRAHKEMNsrlqqqqqhgnsyrehhmdqdfrgrpspghsprqspstlhspasknspkaspsntyns 363  Japanese medaka
XP_029317698  242 ---FQCTIQALQDELRIQRDLN---------------------------------------------------------- 260  Cottoperca gobio
XP_031143341  235 ---LQMTIQALQDELRTQRDLN---------------------------------------------------------- 253  pike-perch
XP_018670964  124 ---LHLTTQALQDELRAQRDLN---------------------------------------------------------- 142  vase tunicate
Q811U3        244 -----------------------------------------QLFQQD--S--------------SSRTGEPcvaeltee- 265  Norway rat
9_pfamImport   78 -----------------------------------------QLLHDDftM--------------NPVDTEN--------- 93  
XP_009296283  250 -----------------------------------------QLLQPP---------------------GEPlace----- 262  zebrafish
Q6PH08        240 -----------------------------------------HLLQQE-----------------SGNRGAEhftieltee 261  house mouse
1_pfamImport   93 ---------------------------------------twHMLTSE-----------------TGRGGQEkrwtkalse 116 
6_pfamImport   91 -----------------------------------------SRSQHHrqQ--------------GNSYRElhmdqdlre- 114 
8_pfamImport   99 -----------------------------------------SRLQQQrqQvp-----------gCDGFSSPppvdqsee- 125 
XP_022538566  249 -----------------------------------------HLLQQEs-S--------------SRGSGAEhfttielte 272  Mexican tetra
XP_023812415  364 rqqeadiiihspgygcntavatqrlspantlqpglknssnlSLYNPNytTgvvpscnslrprspCQVPRCDgfssprldp 443  Japanese medaka
XP_029317698  261 -----------------------------------------QLFQSDysE--------------SGHLGHQpippqemte 285  Cottoperca gobio
XP_031143341  254 -----------------------------------------HLLQQE--G--------------GNRSASDhfttielte 276  pike-perch
XP_018670964  143 -----------------------------------------QLLHEDfvT--------------SPSDGGDkestr---- 163  vase tunicate
Q811U3        266 -----nfqrlhaeHERQAKELFL--LRKTLEEMELRIETQKQTLNARDESIKKLLEMLQSKGLSAKa----tEEDHERTR 334  Norway rat
9_pfamImport   94 -------------YERTVRENEL--LQSTLEELETRIEAQRQTLETRDESVRKLLEMVQCKGLPKPdd--ggSDTDALRA 156 
XP_009296283  263 ---------pseeQERQARELFL--LRRTLEEMELRMEAQRQTLVARDDSVKKLLEMLHSKGPSAKa----sEEDHERTR 327  zebrafish
Q6PH08        262 -----nfrrlqaeHDRQAKELFL--LRKTLEEMELRIETQKQTLNARDESIKKLLEMLQSKGLPSKs----lEDDNERTR 330  house mouse
1_pfamImport  117 iewrvmrrrsedvHDRRSESLELcrLRPSLWHLEIRFTVRKGSMNSTFLQCKELSATLQMKALTKKs----iFFKSERTR 192 
6_pfamImport  115 ----enffqlqseHERQAKELSL--LRKTMEEMEMRIDSQKQTLGARDESIQRLLEMLQGQSQGQG------QGHWGRGQ 182 
8_pfamImport  126 -----nfyrlqseRERQIKELFL--LRKTVEEMEMRMDSQKQTLGARDESIQRLLEMLQGQGHGPGq----gQGHWGRGQ 194 
XP_022538566  273 ----enfrrlqaeHDRQAKELFL--LRKTLEEMELRIETQKQTLGARDESIKKLLEMLQSKGLPPVagraseEEEQDRAR 346  Mexican tetra
XP_023812415  444 s--eenffrlqseHDRQAKELSL--LRKTMEEMETRINSQKQTLGARDESIQKLLEMLQGQGQAQ--------GHWGRGQ 511  Japanese medaka
XP_029317698  286 ----enflhlhgeYERHVKELFL--LRKTVEEMELRIDTQKHTLTARDESIKKLLEMLQSKGLSSRa----tEEDHERTR 355  Cottoperca gobio
XP_031143341  277 ----enfrrlqaeHDRQAKELFL--LRKTLEEMELRIETQKQTLGARDESIKKLLEMLQSKGLPPGpgrvseEEEQERAR 350  pike-perch
XP_018670964  164 --------imqdnYDRLLRENEL--LQSTMEELESRIEAQRQTLGTRDESVRKLLEMLQCKGLPKSddeglnVEVDSMKA 233  vase tunicate
Q811U3        335 RLAEAEMHVHHLESLLEQKEKENNMLREEMHRRFENAPD--SAKTKALQTVIEMKDSKISSMERGLRDLEEEIQMLKSNG 412  Norway rat
9_pfamImport  157 QIVGYEARLASMEGLLQEKKMELQKFKVSIKSKYSGSNDgmSSNIEAYRQLLEAKESKILSLERSNHELELELESVNHNA 236 
XP_009296283  328 RLADAEMHAHHLENLLEQRDKELVALREELHRRLEGTPE--TTKTKALQTVIEMKDSQIGSLERGLRELEDQVMMLRSSS 405  zebrafish
Q6PH08        331 RMAEAESQVSHLEVILDQKEKENIHLREELHRRSQLQPE--PAKTKALQTVIEMKDTKIASLERNIRDLEDEVQMLKANG 408  house mouse
1_pfamImport  193 RMAEAESQVNHLEVILDQKEKENLHLREELHRRNQVQQE--PAKTKALQTVIEMKDTKIASLERNIRDLEDEIQMLKTNG 270 
6_pfamImport  183 RTGIITMAAQEAEAQL-----ENVHLREELHRRNQLQAD--PAKTRALQTVIDMKDTKISSMERNIRDLEDEVQMLKTSG 255 
8_pfamImport  195 RPGIIAMAAQEAEAQL-----ENIHVREELHRRNQLQAD--PANTRALQTVIDMKDTKISSLERNIRDLEDEVQMLKTSG 267 
XP_022538566  347 RIAEAEAQLGHLEVILDQKEKENIHLREELHRRNQLHQD--PSKTKALQTIIEMK------VKRVY--SSQLQNTDYTTL 416  Mexican tetra
XP_023812415  512 RTGIITMAAQEAEAQL-----ENMHVRE---------------------------DTKISSLERNIRDLEDDVQMLKTSG 559  Japanese medaka
XP_029317698  356 RLADAEMTIHQLEGLLEQKDKEMLQLREELHRRYEAAPE--STKTKALQTVIEMKDAKISSMERGMRELEEEVNMLKSNG 433  Cottoperca gobio
XP_031143341  351 RIAEAEAQLGHLEVILDQKEKENIHLREELHRRNQLHQD--PSKTKALQTIIEMKDTKIASLERNIRDLEDEIQMLKANG 428  pike-perch
XP_018670964  234 QIIGYQSRLGHMESLLHDKNIE------VQQYKNRCLDG--NEETSTIHKVIDAKEAKISSLERMNREVELELESTKHEA 305  vase tunicate
Q811U3        413 ALSTEEREEEMKQMEVYRSHSKFMKNK-------------------------------IGQVKQELSRKDTELLALQTKL 461  Norway rat
9_pfamImport  237 EVGMTQHNEDMKQLEVVKSHADFMKHK-------------------------------VGELDSDVQKKETEIVTLQTRL 285 
XP_009296283  406 MLSCEERQEEAKQMEVYRNHTKFMKNK-------------------------------MDQVKQDLSRKDTQLLGLQTKL 454  zebrafish
Q6PH08        409 VLNTEDREEEIKQIEVYKSHSKFMKTK-------------------------------IDQLKQELSKKESELLALQTKL 457  house mouse
1_pfamImport  271 LLNTEDREEEIKQMEVYKSHSKFMKNK-------------------------------IDQLKQELSKKESELLALQTKL 319 
6_pfamImport  256 LLHSDERQDELKHVEVYKSHSKFMKTK-------------------------------IEQLKQELNRKESEMQALQTKL 304 
8_pfamImport  268 LLHPYDRQDELKQVEVYKSHSKFMKSK-------------------------------IEQLKQELNRKESEMQALQTKL 316 
XP_022538566  417 LHHYII---EIKQMEVYKNHSKFMKSK-------------------------------IDQLKQELSKKESELLALQTKL 462  Mexican tetra
XP_023812415  560 VLHSDDRHSELKQVEVYNSHSKFMKTKekalspcvssirptpsflfptqhpwiteqaeIETLKQELNKKESEMQALHTKL 639  Japanese medaka
XP_029317698  434 ALSSEEREEEIKQMEVYRSHSKFMKNK-------------------------------MEQAKQDLGRKDSELLAFRTKL 482  Cottoperca gobio
XP_031143341  429 LLNTEDREEEIKQMEVYKNHSKFMKNK-------------------------------IDQLKQELSKKESELLALQTKL 477  pike-perch
XP_018670964  306 DIIMTQHREDVKQLEAVKSHSDFMKNK-------------------------------VDQLKSDVQKKETEIVTLQTRL 354  vase tunicate
Q811U3        462 ETLTNQFSDsKQHIEVLKESLTAKEQRAAILQTEvdalr--lrleeKETMLNKKTKQIQDMAEEKGTQAGEIHDLKDMLD 539  Norway rat
9_pfamImport  286 DTLNNQQSD-RQHIDVLKESLAAKDQRASVLQSE------------KQAVLDEKQDYLLRLQEDKSGDTAELSHLRDTLD 352 
XP_009296283  455 ETLTNQFSDsKQHIEVLKESLTAKEQRAAILQTEvdalr--lrleeKETTLNKKSKQIQEMSEEKSTLNGEIHDLKDMLD 532  zebrafish
Q6PH08        458 ETLSNQNSDcKQHIEVLKESLTAKEQRAAILQTEvdalr--lrleeKESFLNKKTKQLQDLTEEKGTLAGEIRDMKDMLE 535  house mouse
1_pfamImport  320 ETLTNQNSDcKQHIEVLKESLTAKEQRAAILQTEhlvdelnlnyerKATFLNNWSEKLRFKTSQCGTLFHAVENLQQMLV 399 
6_pfamImport  305 ETLTNQNSDcKQHIEVLKESLSAKEQRANTLQTEvdalr--vrleeKEQFLTKKTKQLQDLTDEKSTLTGEIRDMKDMLD 382 
8_pfamImport  317 ETLTNQNSDcKQHIEVLKESLSAKEQRANTLQTEvdalr--vrleeKEQLLTKKTKQLQDLTDEKSTLSGEIRDMKDMLD 394 
XP_022538566  463 ETLNNQNSDcKQHIEVLKESLTAKEQRSAILQTEvdalr--lrleeKESFLNKKSKQLQDLTEEKGTLAGEIRDMKDMLE 540  Mexican tetra
XP_023812415  640 ETLTNQNSDcKQHIDVLKESLAAKEQRANTLQTEvdalr--vrleeKEQLLTKKTKQLQDLNDEKSTLTGEIRDMKDMLD 717  Japanese medaka
XP_029317698  483 ETLNNQFSDsKQHVDVLKESLTAKEQRAAILQTEvdalr--lrleeKESLLAKKSQQISELTEEKSTQQGEISDLKDMLD 560  Cottoperca gobio
XP_031143341  478 ETLNNQNSDcKQHIEVLKESLTAKEQRAAILQTEvdalr--lrleeKESFLNKKTKQLQDLTEEKGTLAGEIRDMKDMLE 555  pike-perch
XP_018670964  355 DTLNNQQSDnRQHIDVLKESLNAKDQRASVLQSEvdslr--nrldeKQRILDEKQDYLLRLQEDKSCDASELSHLRDTLD 432  vase tunicate
Q811U3        540 VKERKVNVL--QKKIENLQEQLRDKEKQMSSLKERVKSLQADTTNTDTALTTLEEALADKERTIERLKEQRDRDEREKQE 617  Norway rat
9_pfamImport  353 VKDRKIMVL--HKKIESLSEVLRDKDRVLDENKRAMAELEQDSCTSDSALTTMEEALADKDKVVEALQKEHASSCQQFRD 430 
XP_009296283  533 VKERKVNVL--QKKIENLQEQLRDKEKQMSSLRERVKSLQTDTSNTDTALTTLEDSLAEKERIIERLKEQRDREEREKAE 610  zebrafish
Q6PH08        536 VKERKINVL--QKKIENLQEQLRDKDKQLTNLKDRVKSLQTDSSNTDTALATLEEALSEKERIIERLKEQRERDDRERLE 613  house mouse
1_pfamImport  400 IKKRKVGGItkQKKIENLQEQLRDKDKQLTNLKDRVKSLQTDSSNTDTALATLEEALSEKERIIERLKEQRERDDRERLE 479 
6_pfamImport  383 VKERKIIVL--QKKIENLLEQLKDKDKQVAGLRERVQGLQTDSSNTDTALATLEEALSEKERVIENLREQKDREDRVRLE 460 
8_pfamImport  395 VKERKVNVL--QKKIENLLEQLKDKDKQLAGLRERVQGLQTDSSNTDTALTTLEEALSEKERVIEALREQKDREDRVRLE 472 
XP_022538566  541 VKERKINVL--QKKIENLQEQLRDKDKQLGNLKDRVKSLQTDSTNTDTALATLEEALSEKERIIERLKEQREREDRERME 618  Mexican tetra
XP_023812415  718 VKERKVNVL--QKKIENLLEQLKDKDKQLAGLRERVQGLQTDSNNTDTALATLEEALSEKERVIENLREQKEREDRARTE 795  Japanese medaka
XP_029317698  561 VKERKVNVL--QKKIENLQDQLRDKEKQLGGLKDRVKSLQTDTSNTDTALGTLEEALAEKERIIERLKEHREREEREKGD 638  Cottoperca gobio
XP_031143341  556 VKERKINVL--QKKIENLQEQLRDKDKQLGNLKDRVKSLQTDSSNTDTALATLEEALSEKERIIERLKDQREREDRERLE 633  pike-perch
XP_018670964  433 VKDRKILVL--HKKIESLSEVVRERDGMLEEKKRALVALEEDSCTSDSALTTMEEALADKDKIVEALQHEISLLRQQLRD 510  vase tunicate
Q811U3        618 EIDTYKKDLKDLKEKVSLLQGDLSEKEASLLDLKEHASSLASSG-LKKDSRLKTLEIALEQKKE---ECLKMESQLK--- 690  Norway rat
9_pfamImport  431 ESADLRQCLKNAEQQLDSLRREMSEKESSISELQERASSLASSM-VKKDSHIKQLEINVQKSFD---DVTRLQTQHL--- 503 
XP_009296283  611 ELDTSKKELKELKEKVSLLQGDLSDRETSLLDLKEHASSLASSG-LKKDSKLKSLEIALEQRRE---ECSKLENQLK--- 683  zebrafish
Q6PH08        614 EIESFRKENKDLKEKVNALQAELTEKESSLIDLKEHASSLASAG-LKRDSKLKSLEIAIEQKKE---ECNKLEAQLK--- 686  house mouse
1_pfamImport  480 EVESYKKENKDLKEKVNALQAELTEKESSLIDLKEHASSLASSG-LKKDSKLKSLEIAIEQKKE---ECSKLESQLQ--- 552 
6_pfamImport  461 ELEQLRKENHELKDKLSVMQPQKQPQNQPGNPSP--SQNQRPDGeVSMDSSIKSIELMFSLRRP---GCQKLKAQKHiy- 534 
8_pfamImport  473 ELEQMRKENQVLKETLSALQPHKLPQSQPANSVL--TQNQRPDG-----AKIDSLEIEVETKVDkppTGSATVGSLYfml 545 
XP_022538566  619 ELESYKKENKDLKEKVSTLQVELTEKESSLIDLKEHASSLASSG-LKKDSKLKSLEIAMEQKKE---ECSKLETQLQk-- 692  Mexican tetra
XP_023812415  796 ELEQMRRENQILKDKLSAQQPIKLSQS----PAPNHTSTQDQRP-----------DGEVQVKVD---PAIG-----P--- 849  Japanese medaka
XP_029317698  639 EVESSKKELKELREKVSHLQTDLADRETSVLDLKEKASSLASSA-LKKDNRLKSMEISLEQKRE---ECVKLENQLK--- 711  Cottoperca gobio
XP_031143341  634 EVESYKKDNKDLKEKVNSLQIELTEKESSLIDLKEHASSLASSG-LKKDSKLKSLEIAIEQKKE---ECSKLETQLQkqa 709  pike-perch
XP_018670964  511 ESADLNQQLKNAEQQLDCSRRDVTERETSISELQEQATSLASSI-VKKDSFIKQLEINIQKHTE---DFNRLQNQHK--- 583  vase tunicate
Q811U3        691 ----------KAHEATLEA--RASPEMSDRIQQLEREIARYKDESSKAQTEVDRLLEILKEVENEKNDKDKKIAELESLT 758  Norway rat
9_pfamImport  504 ----------KAQQLAMSE--TTKEEFNSKIQTLENEVKLKAEEATRCQGDLDRLLGILKETENEKHLKDKKIATFEKRC 571 
XP_009296283  684 ----------KAHSAAVNA--QANAEISERISSLEADVSRHREDSAKAQAEVDRLLDILRQMENEKNDKDRKISELErq- 750  zebrafish
Q6PH08        687 ----------KAHNIEDDS--RMNPEFADRLKQLDKEASYYRDECGKAQAEVDRLLEILKEVENEKNDKDKKIAELESLT 754  house mouse
1_pfamImport  553 ----------KAHEAEEAA--RVNPEIVNKVKHLEKEVAYYKEESGKCQAEVERLLDILREVETEKNDKDKKIAELESMT 620 
6_pfamImport  535 ---------sKIQTTEEAV--KICPDITDRLRVLEQEVGRYREESRKSQAEVERLMGALKDAEMDKSCKEKKISDLERDM 603 
8_pfamImport  546 lc----lwyrKTQNMEETV--RKCPDITDRLRLLEQEVARNKEESGKSQSEVERLMAALRDAEMDKLCKEQKIENLESCI 619 
XP_022538566  693 ----------KAHEVEVVQgsRGNPDFLDRVKLLEKEVNFFKEESNKSQAEVERLLEILREVESEKNDKDKKIAELEsla 762  Mexican tetra
XP_023812415  850 ----------TTQNMEDAV--RIGPDIADRLRLLEQEVARYREESSKSQAEVERLMGALRDAETEKSSKEKKIADLErpg 917  Japanese medaka
XP_029317698  712 ----------KAHNSASDS--QASIELSDQISCLEQEVTRHKEDAGKAQSEVERLLEILREMENEKNDKEKKINELESLA 779  Cottoperca gobio
XP_031143341  710 eqlfshmnnpKAHEVELQSgpRGNPEYVDRVKLLEKEVSYYKDEANKAQTEVERLLDILREVETEKNDKDKKIAELESLA 789  pike-perch
XP_018670964  584 ----------KAQQQAMTE--TTKEEFNLKIRNLEIEVQSKVDEASRCQGDLDRLLGILKETENEKHSKDEKISAMEKk- 650  vase tunicate
Q811U3        759 sr----qvKDQNKkv----------aNLKHKEQVE----KKks-------------aQMLEEARr-------------rE 794  Norway rat
9_pfamImport  572 --------KEQAT-------------KIKSMQNEMiqdaQRkgaaqdrdikskdervEELEEALresvsitaeremllaK 630 
XP_009296283  751 -------mKEQSKksgkhkeppgkgrNVNDGPQQEslrqKAer-------------iEELEEALresvqitaeremvlaQ 810  zebrafish
Q6PH08        755 lr----hmKDQNKkv----------aNLKYNQQLE----KKkn-------------aQLLEEVRr-------------rE 790  house mouse
1_pfamImport  621 lr----qvKDQNKkv----------aNLKHNQQVE----KKkn-------------aQLLEEGRk-------------rE 656 
6_pfamImport  604 tirflflqKKYKV-------------NIKQKYQIT----KSk--------------gNTLEENLkr------------tD 640 
8_pfamImport  620 llmflrpkKCEPV-------------NLKASQQFK----TRka-------------aALLQLHSrp------------sT 657 
XP_022538566  763 p----rpgKEQNKkg----------pNIKLGQPGD----KKg--------------sSILQDPR---------------K 795  Mexican tetra
XP_023812415  918 ------qiKSPNI-------------QKQMVPCEM----RK----------------DVLVDGH---------------- 942  Japanese medaka
XP_029317698  780 sr----qmKDQSKkv----------aNFKHKEQLE----KSrn-------------aQLMDDARk-------------rE 815  Cottoperca gobio
XP_031143341  790 prq---ggKDLTKkg----------pNIKLGPQGD----KK----------------GLGQDPR---------------K 821  pike-perch
XP_018670964  651 -------hKEQTM-------------KIKSLQTEMieeaRRkgaaq---------------------------------- 676  vase tunicate
Q811U3        795 DSLSDSSQQLQ--------------------------------------------VEELLMAMEKVKQELESMKAKLSST 830  Norway rat
9_pfamImport  631 MDEKAKASQQQ--------------------------------------------LSETTEELSKTKSKLDEVGKKLTSV 666 
XP_009296283  811 EEAARNHQEKQ--------------------------------------------MEELLGAMEKVKLELESMKAKMSST 846  zebrafish
Q6PH08        791 DSMVDNSQHLQ--------------------------------------------IEELMNALEKTRQELDATKARLAST 826  house mouse
1_pfamImport  657 DNRTDNSQHLQ--------------------------------------------LEELMNALEKTRQELDATKQRLSST 692 
6_pfamImport  641 EVKHETYAHLQ--------------------------------------------LEELMGALEKTRQELDATKLRLSST 676 
8_pfamImport  658 DALASDSREKQ--------------------------------------------LEELMGALEKTRQELDATKLHLSST 693 
XP_022538566  796 DNPMDNP---K--------------------------------------------MEELMNVLEKTRQELDATKQRLTST 828  Mexican tetra
XP_023812415  943 -----PHSLSQ--------------------------------------------LEELMGALEKTRQELDATKLRLSST 973  Japanese medaka
XP_029317698  816 DNLNECSLQIKdslrqkeerieeleealresvqitaerevvlaqeeqgrthsekqVEDLLVAMERVKQELDVMKAKLSST 895  Cottoperca gobio
XP_031143341  822 DSSMDSGHHVK--------------------------------------------LEELMNTLERTRQELDSTKQRLSST 857  pike-perch
XP_018670964  677 ---drdvAKYLsemqtkderveeleealresvsitaerevvlagveegrrvaenqLAELVAEFTKTKQVLEETGMRVASM 753  vase tunicate
Q811U3        831 QQSLAEKETHLTNLRAERRKHLEEVLEMKQEALLAAISEKDANIALLELSSS-KKKTQEEVAALKREKDRLVQQLKQQTQ 909  Norway rat
9_pfamImport  667 ESSLTSKDRILVKMKMERRKQLEERLEMKQEALLAAISEKDSNIALLELSQSrKKTNAEEVCLLRREKDSLVQQLKQQTQ 746 
XP_009296283  847 QQSLAEKEAHLTTLRAERRRHLEEVLEMKQEALLAAISEKDANIALLELSSSkKKKTQEEVAQLRREKDRLVQQLKQQTQ 926  zebrafish
Q6PH08        827 QQSLAEKEAHLANLRIERRKQLEEILEMKQEALLAAISEKDANIALLELSASkKKKTQEEVMALKREKDRLVHQLKQQTQ 906  house mouse
1_pfamImport  693 QQSLAEKEGHLTNLRLDRRKQLEEILEMKQEALLAAISEKDANIALLELSASkKKKTQEEVMALKREKDRLVHQLKQQTQ 772 
6_pfamImport  677 QQSLHERDGHLNSLRQERRKQLEEILEMKQQALLAAISEKDANIALLELSSSkRKKAQEEVMALKREKDRLMHQLKQQTQ 756 
8_pfamImport  694 QQSLHERDGHLNSLRHERRKQLEEILEMKQQALLAAISEKDANIALLELSSSkRKKSQEEVMALKREKDKLMHQLKQQTQ 773 
XP_022538566  829 QQSLTERDGHLTNLRQERRKQLEEILEMKQQALLAAISEKDANIALLELSSSnKKKTQEEVMSLKREKDRLMQQLKQQTq 908  Mexican tetra
XP_023812415  974 QQCLHERDGHLSNLQHERRKQLEEILEMKQQALLAAISEKDANIALLELSSSkRKKAQEEVMALKREKDRLMHQLKQQTQ 1053 Japanese medaka
XP_029317698  896 QLSLAEKEGHLTALRAERRKHLEEVLEMKQEALLAAISEKDANIALLELSSSkKKKTQDEVAALKREKDGLVHQLKQQTQ 975  Cottoperca gobio
XP_031143341  858 QQSLQERDGHLTNMRQERRKQLEEILEMKQQALLAAISEKDANIALLELSASnKKKTQEEVLALKRERDKLMHQLKQHTQ 937  pike-perch
XP_018670964  754 EVMVESKDRMLEKLRGERRKQMEEALEMKQEALLAAISEKDSNIALLELSQPrKKSNADEVCLLRREKDALVQQLKQQTQ 833  vase tunicate
Q811U3        910 NRMKL 914  Norway rat
9_pfamImport  747 NRLKL 751 
XP_009296283  927 NRMKL 931  zebrafish
Q6PH08        907 NRMKL 911  house mouse
1_pfamImport  773 NRMKL 777 
6_pfamImport  757 SRMKM 761 
8_pfamImport  774 SRMKL 778 
XP_022538566  909 srmkl 913  Mexican tetra
XP_023812415 1054 SRMKL 1058 Japanese medaka
XP_029317698  976 NRMKL 980  Cottoperca gobio
XP_031143341  938 SRMKL 942  pike-perch
XP_018670964  834 NRLKL 838  vase tunicate
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap