Conserved Protein Domain Family
Mit_KHE1

?
pfam10173: Mit_KHE1 
Mitochondrial K+-H+ exchange-related
The members of this family function as mitochondrial potassium-hydrogen exchange transporters. The family is part of a large mitochondrial KHE protein complex.
Statistics
?
PSSM-Id: 401981
View PSSM: pfam10173
Aligned: 116 rows
Threshold Bit Score: 126.16
Threshold Setting Gi: 470272645
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
EDK44050      73 VISLPITTkQSFIYCNHRPgilsktqaSKIEL----------------------------VTKIEAKLVNLATKGWNKLT 124 Lodderomyces el...
XP_005849796   7 VLLLPIFR-RHWLWHaeg------gaaAAAAAaadvqgkagqalrnwregrnleekvqllGQRANRWVQRRLWTEWHKLE 79  Chlorella varia...
XP_009391193   5 LVVFPIKG-RSWCFSRSAEs-------VSGADssstpppglrdlw--rrisshgrsaqesAEIVGDFIADKMNRAWTGLE 74  wild Malaysian ...
KRH47727       5 LFVFPIRG-RNWCFSRTIDh------sLSASHassqspstlkdlw--tninvgdkplntkTELFVDYIANKMNNAWIGLE 75  soybean
XP_006357432   5 LVVFPIRG-RNWCFSRSIEs-------SQSEAqssntpstlkdlwkkissksshdspaanIEVVVDFASDKMNKAWTSLE 76  potato
EEF29062       5 LVVFPVKG-RNWCFSRSIEp-------SVAEAasayapntlkelw---knisssnsnahnAELVIDFVSNKMNRAWVGLE 73  castor bean
XP_006369072   5 LVVFPVKG-RNWCFSRSIDp-------SLEEAaashtpstlkhlw--kkissssnssaknVELVIDYASNKMDKAWMGLE 74  black cottonwood
CBI35786       5 LVVFPIKG-RKWCFARSVDp-------AAADSqaahtpstlrdlw--nrissnpkplnanAELLLDFASNKMNKAWVGLE 74  wine grape
XP_009123652   5 LVVFPIKG-RKWCFSRSVDp-------FAAQTpsgvtpttvrglw--kklsseskpinanAELLVDFISDKMNKAWTGLE 74  field mustard
ERM99439       5 LVIFPIRG-RSWCFTKSIDk-------VAQDSgfnpssltlkdlw--kritkneegvqgkAEIVTEFFSEKMNRAWLALG 74  Amborella trich...
EDK44050     125 TSKLK-INIKITHFIKQLLDTIPYKESCLRSFPnknamireineeslhlikptkksenenenenekenknknknknknkn 203 Lodderomyces el...
XP_005849796  80 TASEGtLRNRGYRMAQAVLAREDPRETFLKNLP----------------------------------------------- 112 Chlorella varia...
XP_009391193  75 KAPAGtLKSKIHSLGLRLLSRVKPSEIFLKSVT----------------------------------------------- 107 wild Malaysian ...
KRH47727      76 KAPEGsFKNKIHGLGLRLLSRVKPSEIFLKSIS----------------------------------------------- 108 soybean
XP_006357432  77 KAPAGsLKNRIHGLGLTLLSRVKPSEIFLKSIS----------------------------------------------- 109 potato
EEF29062      74 KAPEGtLKNKLHGLGLKLLSRVKPSEIFLKSIS----------------------------------------------- 106 castor bean
XP_006369072  75 KAPEGtFKNKLHGLGLKLLSRVKPSEIFLKSIS----------------------------------------------- 107 black cottonwood
CBI35786      75 KAPEGtLKNKLYGLGLRLLARVKPSEIFLKSIS----------------------------------------------- 107 wine grape
XP_009123652  75 KAPEGsMKNKIHGLGLKLLARVKPSEIFLKSIS----------------------------------------------- 107 field mustard
ERM99439      75 EAPDGsFKHKIHGMGQLLLARVQPSEFFLKSIS----------------------------------------------- 107 Amborella trich...
EDK44050     204 eiedgnviqskstgdtktdietaraseissqsaknegvnprptvivqsevqnldiptNQLKPIPLYHP-QFqSPSTIREE 282 Lodderomyces el...
XP_005849796 113 ---------------------------------------------------------SKPAPVEVIYPtAY-KERMVRRQ 134 Chlorella varia...
XP_009391193 108 ---------------------------------------------------------KDITTVEITYPaNL-NPRFVRRR 129 wild Malaysian ...
KRH47727     109 ---------------------------------------------------------KEITSVEIIYPsSL-NAQLVRRR 130 soybean
XP_006357432 110 ---------------------------------------------------------KEVTRVDITYPsSL-NGQLVRRR 131 potato
EEF29062     107 ---------------------------------------------------------KEVTDVEIIYPsSL-NPRLVRRR 128 castor bean
XP_006369072 108 ---------------------------------------------------------KEVSSVEITYPsSL-NARLVRRR 129 black cottonwood
CBI35786     108 ---------------------------------------------------------KEVSKVHVAYPsSL-NARLVRRR 129 wine grape
XP_009123652 108 ---------------------------------------------------------KEVTSIQVSYPpSL-DPRLVRRR 129 field mustard
ERM99439     108 ---------------------------------------------------------KDITEVEVTFPaSL-NPRLVRRR 129 Amborella trich...
EDK44050     283 LQEFRDHGLEHEKKWAIICAIGIPITLPFALVPVvPNVPGFYVAYRLYCHIKALYGIRNLDYLL 346 Lodderomyces elongisporus NRRL ...
XP_005849796 135 LRHVAADGRRRHTMRLVWWMLAMVPQLPLMLTPL-PNITVYYTGYRIYSHFRALQGTKALEQNL 197 Chlorella variabilis
XP_009391193 130 LRHMAMWGSAVHRNYFYGSISLLPLTSVLSVLPL-PNIPFFWILFRTYSHWRALKGSERLMLLV 192 wild Malaysian banana
KRH47727     131 LRHIAVRGAVIHRNYLYGLVSLIPLTSALSILPL-PNVPFFWVLFRTYSHWRALQGSERLFQLV 193 soybean
XP_006357432 132 LRHIASRGAIIHKKYLYGSATLLPLTSFFMVLPL-PNIPFFWVLFRTYSHWRALQGSENLLRLV 194 potato
EEF29062     129 LRHVALSGSAIHKKYFYSSVSLLPLTSAFMVLPL-PNIPFFWVLFRAYSHWRALQGSEKLLELV 191 castor bean
XP_006369072 130 LRHIAMRGAAIHKKYFYGSVMLLPLSSALAVLPL-PNIPFFWFLFRSYSNWRALKGSEKLLQLV 192 black cottonwood
CBI35786     130 LRHVALRGNFIHKKYFYGSVSLLPFTFAFSVLPL-PNIPFFWISFRTYSHWQALQGSERLLRLV 192 wine grape
XP_009123652 130 LRHIAMSGTILHKKYLIGSVTLLPLTSAFMVLPL-PNIPFFWVLFRTYSHWRALQGSEQLLKLL 192 field mustard
ERM99439     130 LRHVAMRGSIYHRRFFYGSMSLLPFTTALAVLPL-PNIPFFWILFRAYSHWRACQGSERLLLLa 192 Amborella trichopoda
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap