Conserved Protein Domain Family
Tim29

?
pfam10171: Tim29 
Translocase of the Inner Mitochondrial membrane 29
This is a family of proteins conserved from nematodes to humans. The function is not known. However, family members such as the import inner membrane translocase sub-unit Tim29 (C19orf52) found in human, is shown to be required for the stability of the TIM22 complex. TIM22 complex imports and inserts multi-pass trans-membrane proteins into the mitochondrial inner membrane by formation of a twin-pore translocase with components in the outer and inner membranes. TIM29 is integrated into the inner member with the C-terminus exposed to the inter-membrane space and able to contact the translocase of the outer membrane. It is required for complex stability and for the addition of the TIMM22 protein to the complex.
Statistics
?
PSSM-Id: 401979
View PSSM: pfam10171
Aligned: 32 rows
Threshold Bit Score: 180.115
Threshold Setting Gi: 167524691
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
XP_796186            16 KMPERLKTGlpkKIGEYLSNMHRDYKAATVDVFTDMKERPFKAAFYIASLSAIGYMGSQAPDEENFEKELVEASNDLLLL 95  purple s...
XP_004929618         20 KFPEKFKGTiieKWADYWKNLFIDYRQMLQDLRSDIQDDPMKAMKWTTGIITFYLLSRNNPTECDFKDNLKIINNEVGLV 99  domestic...
XP_002431373         24 NVPEKAKGTvveKWIKYWEGLINDYADVFRDSIKESKSKPYKTGLLALSGCFLTYAVYNNPTEQDFRDSVIYYQNLFGLV 103 human bo...
Q9W4R8               22 QMPERFKGTfveKWVQYWNGLVRDYTEVAVGVVRESYTKPKKALLYGTGMLFMYQANLKNPGEEAFMTLLRGATNRMITV 101 fruit fly
Q29ID6               22 VLPERFKDTfveKWVKYWKGLVRDYSEVALGVVKESYTKPKKALAYGTGILCLYQMAQHNPDEGVFMTQLRRDNSRMIMV 101 Drosophi...
XP_002071750         22 VLPERFKGTvveKWVNYWHGLVRDYSEVTIGVVKESYAKPKKALAYATGITLLYKAVENNPDHEAFMTILRRNSNRMITV 101 Drosophi...
WGS:AANI:GJ19390-PA  22 TLPERFKGTvveKWANYWKGLLRDYSEVAVGVIKESYAKPKKTLAYGTCLIALYQTAKNNPDHLAFMTLLRKQTNRMITL 101 Drosophi...
XP_001990904         22 TLPDRFKGTtveKWANYWKGLMSDYAEVATSVVKESYARPKRTLIYGTAIVALYQMAKNNPDQYAFSSLLRTQTNRMITL 101 Drosophi...
NP_001313596         28 SFPERFRGTileRWKQYWESVAKDYYESTVGIGTYARANPIKSSLAVVTASCAYYCASTNPDEHSYRSEILDCANTMLYI 107 pea aphid
XP_011419369         12 TLPEKFKGGkleKIGSFIYSIINDYKVVAQETIQDCKDRPVKASLYISLLSFVGVLYKTNPTERDFRQELIEDGQEMLLI 91  Pacific ...
XP_796186            96 SNLTRNQGSDLHVQKMMALQNAGVLRYMSLGVCSLIWEDHFDKRVALYDAKCDYLTVSWREFPDRIRDVGFMGRWHYLSK 175 purple s...
XP_004929618        100 SEECLNPKAVEHLRFLDTCYNQEVIHYRSLGILSVMYTSELSNSCDLYRAHCTYTKPTYFSFPSRIVDIGFMGKWWNLFI 179 domestic...
XP_002431373        104 GKPVRNPGVDVYLKSLENSFNFKVIRRLSLGIFCFIWIDNYDEALGLYKAQCKYLKPRYLTFYERVIDVGFLNKFWILEK 183 human bo...
Q9W4R8              102 PVELQNPVSADYLLTLERAINQKKLRLLSLGICTILWVDLYDEDDCTYPAICEYTNVGVFNFHERIIDVGFWNQYWRLKW 181 fruit fly
Q29ID6              102 PPERQNHVSAKHLLMLERAINQKKLRFLSLGICTLVWVDLFSEDDCTYPAICEFTNVGFLNFHERVIDVGFWNEFWRLKW 181 Drosophi...
XP_002071750        102 PTERQNPEASQYLVTLERAINQKKLRLLSLGAFTLLWVDLYDEDDCTYPAICEYTTVSWLNFHERVIDVGFWNEFWRLRW 181 Drosophi...
WGS:AANI:GJ19390-PA 102 PPAQQNPESAEYLIMLERAINQKKLRLLSLGFFTLMWVDMYDEDDCTYPAICEYTTVGLLNFHERIIDVGFWNQFWRLKW 181 Drosophi...
XP_001990904        102 PPEQQNSESSDYLVMLERAINQNKLRLLNLGICTLLWVDMFDEDDCTYPAICEYTTVNYLSFHERIIDVGFWNQYWRLKW 181 Drosophi...
NP_001313596        108 SPAVRNPSTVKHLEYIEKCYNVGVVKRLNMLLFSVIWIDEFNNDIQAYKANCKYLKPSVLSVHQRAVDIGFLNVWWRLKK 187 pea aphid
XP_011419369         92 GEPIRNVNTDKYLCRLLEAQRDGRLKYQSLLLFSIIYFDNLSKESDLYEARCKLIKPHWMDFHKNIVEVGILGRFLNLRK 171 Pacific ...
XP_796186           176 AMEDYDINE 184 purple sea urchin
XP_004929618        180 KSTNYDVNY 188 domestic silkworm
XP_002431373        184 NMRDYDINp 192 human body louse
Q9W4R8              182 KMRNYDVNY 190 fruit fly
Q29ID6              182 KMHNYDVNY 190 Drosophila pseudoobscura
XP_002071750        182 KMRNYDINY 190 Drosophila willistoni
WGS:AANI:GJ19390-PA 182 KMRNYDINY 190 Drosophila virilis
XP_001990904        182 KMHNYDVNY 190 Drosophila grimshawi
NP_001313596        188 IMVDYDVNP 196 pea aphid
XP_011419369        172 AMLDYDVNP 180 Pacific oyster
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap