Conserved Protein Domain Family
DUF2367

?
pfam10164: DUF2367 
Uncharacterized conserved protein (DUF2367)
This is a highly conserved family of proteins which contains three pairs of cysteine residues within a length of 42 amino acids and is rich in proline residues towards the N-terminus. The function is unknown. Several members are putatively assigned as brain protein i3 but this was not validated.
Statistics
?
PSSM-Id: 401972
View PSSM: pfam10164
Aligned: 12 rows
Threshold Bit Score: 104.588
Threshold Setting Gi: 242021712
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
XP_006000844  28 SYGTIPAAQ-------VGFQPPPPYPYPAapgfsggpp-pasvqppysSTYTIIQQPa-TTSVVVVG------GCPACRV 92  coelacanth
XP_003229961  35 NYGAIPHAPppyapgyVVPPIPPPHSFPN-------------------TTYTIIQQPlpTTSVVVVG------GCPACRV 89  green anole
XP_009026329  67 NYSSTTTTTnqqttvyTSQPVPPfhqqq----------------qrvlVTAPIV--Pa-DQSIIIVG------GCPVCRI 121 Helobdella robusta
EDV90424      18 mqATMPSAPdtrlitgVHHGAPTapnnmas------------ygafetTPVSIVVHPsqPAQIFLIN------ACPSCRI 79  Drosophila grim...
XP_002431287  17 PYSAYPTEVqqygfqtPVTQQPNytpq-----------------qyipTPTFIQPSPv-NQTVVIMG------GCPSCRT 72  human body louse
XP_002127472  10 AYGHQP----------VYNQQPMPMQQPMpmqqpvinvv-------qqqqqqqqqQP----SVVVVGgqggglGCRRCGA 68  vase tunicate
Q1DGT3        57 NYGSMDSS---------AAKVPLP--IVVppsgpsgp----ggsgiaaTTTTHVVIP---QEIIVVG------GCPACRI 112 yellow fever mo...
XP_001851394  58 NYGSMQSS---------GVKVPLQPGVVVplgqatg------agggpsTTATTVVIP---QEIIVVG------GCPVCRI 113 southern house ...
XP_003964604  30 GYGSIPPP------------APPPYAYPDpqgypsaqtvpavsqqpyhGTYAII-QP----SVVVVG------GCPACRV 86  torafugu
XP_014327891  33 GYGAIPAA------------APPPYHYPDgpgyppaqmgpavsqqpytSTYAII-QP----SVVVVG------GCPACRV 89  southern platyfish
P28662        29 GYGAIPTAPppppypyLVTGIPTshpr-----------------vyniHSRTVTRYP--ANSIVVVG------GCPVCRV 83  house mouse
XP_004071519  31 GYGAIPAA------------GPPPYQFPDgrafpsaqmgpavsqqpcvGTYAII-QP----SVVVVG------GCPACRV 87  Japanese medaka
XP_006000844  93 GVLEDDFTCLGILCAIVFFPIGILFCLALRQRRCPNCGATF 133 coelacanth
XP_003229961  90 GVLEDTFTCLGVLCAIAFFPVGILFCLALRQRRCPNCGATF 130 green anole
XP_009026329 122 GVLQDDFTCLGVCCAIVFFPMGLLFCLLFRERRCNNCGAVF 162 Helobdella robusta
EDV90424      80 GYLEDTFSPLGLCCAIFFFPLGILCCLAMREKRCSNCGATF 120 Drosophila grimshawi
XP_002431287  73 GTLESDFTCCGILCAIFCFPIGILCCLCMKQKKCNQCGATF 113 human body louse
XP_002127472  69 TGLSDSFTCCGICLAIFFFPIGLICCFCMREKKCSGCGApy 109 vase tunicate
Q1DGT3       113 GMLEDDYTCCGICCAIFFFPVGILCCLAMKNRRCSNCGAQF 153 yellow fever mosquito
XP_001851394 114 GMLEDDFTCCGIFCAIFFFPVGILCCLAMKNRRCSNCGAQF 154 southern house mosquito
XP_003964604  87 GVLEDDFTCLGILCAIFFFPLGLLFCFALRQRRCPNCGATF 127 torafugu
XP_014327891  90 GVLEDDFTCLGILCAIFFFPLGILFCFALRQRRCPNCGATF 130 southern platyfish
P28662        84 GVLEYCFTCLGIFLAIVLFPFGFLCCFALRKRRCPNCGAVF 124 house mouse
XP_004071519  88 GVLEDDFTCLGILCAIFFFPLGILFCFALRQRRCPNCGATF 128 Japanese medaka
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap