Conserved Protein Domain Family
DDDD

?
pfam10161: DDDD 
Putative mitochondrial precursor protein
This is a family of small conserved proteins found from nematodes to humans. The C-terminal region is rich in asparagine. Members are putatively assigned to be mitochondrial precursor proteins but this could not be confirmed.
Statistics
?
PSSM-Id: 401969
View PSSM: pfam10161
Aligned: 13 rows
Threshold Bit Score: 111.672
Threshold Setting Gi: 0
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q7QHP6        22 GSGGGQLQLvrLPLRRKYTYRSGALKPMPEITPFGLFGIIATVIPGLLIGATISKNMANFLEENDLFVPSDDDDDD 97  African malaria mos...
Q17ED3        17 GTRSGLMGI--RQLRRKYTYRSGALKPMPNVIPFGLLGVVLTVIPGLLIGATISKNMANFLEENDLFVPSDDDDDD 90  yellow fever mosquito
Q28ED6        24 RASKQSSAVshVPCRTAIATSAGTVLPKPEKVSFGLLRVFTVVIPFLYIGTLISKNFAALLEEHDIFVPEDDDDDD 99  tropical clawed frog
1_pfamImport   1 --TQSGPEQdrVPSRHHISKRSGAIRPRPTQMPFGLLRVFFVVFTFSCFGTLISQHIASLLKYFNVFDPEDDDDDD 74 
XP_003264878  32 AAARSGSGQslVPSRSVIVTRSGAILPKPVKMSFGLLRVFCIVIPFLYVGTLISKNFAALLEEHDIFVPEDDDDDD 107 northern white-chee...
2_pfamImport   1 ----PQLGLqqLQHRTAVNTATGAILAKPKKTAFGLLRIMTVVAPFLYVGTLISKNFAALLEEHDIFVPEDDDDDD 72 
CAG01655      21 TAFASGPGRtvTPARTAVCSSSGAILPKPKKTPFGLIRIALVVVPFLYVGTQISKNFAALLEEHDIFVPEDDDDDD 96  spotted green puffe...
XP_019697457  14 TTFKETNVItkSYLRSAITTPSGAILPEPKRTPFSLLGVISSVVFGLLVGATISKNVANFLEENDLFVPSDDDDDD 89  Jerdon's jumping ant
XP_006570318  14 hNLRKIDGEikLHLRSRTTTPSGAILPEPKRTRFGILSVICSVTLGLIIGTTISKRMANFLEEKELFIPSDDDDDD 89  honey bee
XP_002006274  23 RNNNNSNNIvrRQM-SGIVYRSGAFKPKPEEMPFGLFAILCAVIPGLFVGATISKNVANFLEENDLFVPSDDDDDE 97  Drosophila mojavensis
XP_002049580  19 QQTACNNNIvrRRM-AGVTFRSGAVKPKPSEMPFGLLAIFCAVIPGLFVGATISKNVANFLEENDLFVPADDDDDE 93  Drosophila virilis
EDW32278      21 AGNPSNSIIqrRHM-SGVYFRSGALRPKPDEMPFGLFAIFCAVIPGLFIGATISKNVANFLEENDLFVPSDDDDDE 95  Drosophila persimilis
EDW48408      22 AEHPHNLRIlqRHM-SSVYFRSGAIKPKPEEMPFGLLAIFCAVIPGLFVGATISKNVANFLEENDLFVPADDDDDE 96  Drosophila sechellia
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap