Conserved Protein Domain Family
TMEM214

?
pfam10151: TMEM214 
TMEM214, C-terminal, caspase 4 activator
This is the N-terminal domain of transmembrane family 214, from eukaryotes. The family is localized on the endoplasmic reticulum where it recruits procaspase 4 to the ER and subsequently allows this to be cleaved to caspase 4 so leading to apoptosis.
Statistics
?
PSSM-Id: 401960
View PSSM: pfam10151
Aligned: 14 rows
Threshold Bit Score: 828.607
Threshold Setting Gi: 189042272
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
XP_011490299          8 AGKWEVVKKGKKSSNSGG--------EKRagSGGRRALGesnqeadrrkSAPIKMAETLYG--GFEKIGKKHNKEQVPPA 77  Japanese...
Q6NUQ4                8 VGRWEVVKKGRRPGVGAGa-------GGRggGRNRRALGeangvwkydlTPAIQTTSTLYEr-GFENIMKRQNKEQVPPP 79  human
XP_006561802          3 SGGWELVGRNKKDKNNGKinkltkaeKKKfiENAPKVED----------FLPLSQVKTLYDnlDNNKENKKPPKE--KEN 70  honey bee
EFN79101              3 SGGWELVGK-KKDRTNGKvnkltkaeRKKfiENAPKLED----------FLPLSQVKTLYDnlDGNKETKKSPKA--KEH 69  Jerdon's...
EGI61868              3 SGSWELVRR-KKDRGNDKsnkltkaeKKKfiENAPKVED----------FLPLSQVKTLYDnlDGNKENKKPAKAQGKEH 71  Panamani...
XP_002001979          5 SNQWEVVSKSRKQKNLEKkvta-hteQKRiaAQLPKLEE----------LLPTQQYRNLFAnnNINNSNTNN-KSDSPAK 72  Drosophi...
EDW28302              2 SDQWEVVTKSRKQKNLDKkvta-hteQKRiaAQMPKLEE----------LLPTQQYRNLF------GSTNNNSISNSPAK 64  Drosophi...
WGS:AAPP:GF14050-PA   2 SDQWEVVTKSRKQKNLDKkvva-hteKKRlaAQLPKLEE----------LLPTHQAQ-LFA-----SSNNNNYKSSSPAK 64  Drosophi...
XP_004933467          3 SGQWEVVGKNKKSQNGklks---kedEKKalKNGPKLED----------VVPHSQIKSLYAgmDVDGEKK---------- 59  domestic...
XP_005990959          9 AGKWEVVKKNKKSNNS-----------EKksGGSRKALGesnmp-kidpAPPLKTSDTIYEl-GFDKVAKKQNKEQVPPA 75  coelacanth
XP_011490299         78 --AEPQSKKpSSSnKPPKKS--------------PSNTSTPAAC--RTLEEAFKALDVADLKQQLARSQTLFPDNPSVWV 139 Japanese...
Q6NUQ4               80 ---AVEPKKpGNKkQPKKVA--------------TPPNQNQKQGrfRSLEEALKALDVADLQKELDKSQSVFSGNPSIWL 142 human
XP_006561802         71 ktKENEEKKkQ----QKQQS--------------EKKKHEPKEKppKSIKDALNMINVAELHNVFINSQTRFPEAPLIWL 132 honey bee
EFN79101             70 kmKENEEKKkQQQqKQQQQA--------------EKKKQEPKEKppKNIKDALNAIDIKELNNVLATAQARYPEAPLIWL 135 Jerdon's...
EGI61868             72 ktKENEEKKkQHQ--KQQHV--------------EKKKSEPKEKppKTVKDALNAIDPQELDELLATAQVRFPDAPLLWL 135 Panamani...
XP_002001979         73 stSSAASASsKSKsPRKTNAtaaks-----satdVAKKPPKQAAkaRTLEQAMKQITPDDFAAQLEQVKISCPGSQLRWL 147 Drosophi...
EDW28302             65 ssSSASSSK--NKsPIKKNAiktvgsggnsgggsTKKQMPAPLAkpKTLEQALKHITPDDFAAQLTQVKLSCPGSELRWL 142 Drosophi...
WGS:AAPP:GF14050-PA  65 ssSSGSSTSk-TKsPAKKNTgkna------atagAAGAKKPTSTkpKTLELALKNITPDDFSAQLEQVKLSCPDSELRWL 137 Drosophi...
XP_004933467         60 ---SAKEKKnSDKkGKKQ----------------EKKVEPPKPKipKTIEGALEAIDVTELASIITSNKVRFSNAPLVWL 120 domestic...
XP_005990959         76 ftSEEQQQKkPNMgKQAKKS--------------ASADAGQKPYkyKSLEDALKDIDLTELQQQLEKSQSLFPANPSVWV 141 coelacanth
XP_011490299        140 KDLAGYLNQHLAAPDSEPTLSSFPYDYPYCLTGKELRAVIKSLLGRCSNI-LPDFFDHCVYTMLRELDRqsGEPLHGFRV 218 Japanese...
Q6NUQ4              143 KDLASYLNYKLQAPLSEPTLSQHTHDYPYSLVSRELRGIIRGLLAKAAGS-LELFFDHCLFTMLQELDKtpGESLHGYRI 221 human
XP_006561802        133 KDLAAFLNIKIPVDKEDVIFSGKSKDYPLSIIPKSISSILEKAIDMAGKQtVQLFYENTLTNMATDMVK--GSPVFGHKI 210 honey bee
EFN79101            136 KDLAAFLNVKVPIDKEDAIFSGKPKDYPLSLVPKAISSTLEHVVEMAGQQsAQHFYEITLTSMATDMVK--GIPVVGHKI 213 Jerdon's...
EGI61868            136 KELNAFLNIKIPINKEDAIFSGKPKDYPLSLVPKTISSILERAVEMTGQQtIQIFYENTLTTMATDMVK--GIPVIGHKI 213 Panamani...
XP_002001979        148 SNISSYLNSRLAFD-CDPTFSGRSAQYPSNLASAALKQSILDFLRSVGETnLEYFFYSLLDSMATELNS--GQNVVGYKF 224 Drosophi...
EDW28302            143 SHIALYFNGALSYD-CDPVFSGRSAQYPSNLASAALKKSVVEFLSSVGESnLEYFFYSLLDGMTTDLNN--NQTVVGYKF 219 Drosophi...
WGS:AAPP:GF14050-PA 138 SHVALYFNGALSYD-CDPIFSGRSTQYPSNLASHSLKYLIVEFLGSVGESnLEYFYHSLLDSMATELNN--NQTVVGYKL 214 Drosophi...
XP_004933467        121 KEVANFLNSKIPIEVEDPTFTIYPATYPLSETPDELKRTLSSVLQDAGKAnVQLFFDGTLTALANDLSR--GLHANGHRL 198 domestic...
XP_005990959        142 KDLAGYLNYKLQVLEADPMLSQHSYDYPYSLVGKELKNLIRSLLGKSGDA-VEHLFDHCIYIMLRDQDKa-gESLYGYRI 219 coelacanth
XP_011490299        219 CIQAVLQDKPRIATQNLPEYLELLRSVHNRPAKCLTIMWALGQAGFYDLSQGLLVWLGIMLPVLGVKSLSAYAIAYLERL 298 Japanese...
Q6NUQ4              222 CIQAILQDKPKIATANLGKFLELLRSHQSRPAKCLTIMWALGQAGFANLTEGLKVWLGIMLPVLGIKSLSPFAITYLDRL 301 human
XP_006561802        211 FLQLLAYINPEMTIVNISKLIRVKNSYQNRKNIGLSILWAISQAGRKNLAVGLKVWHEVMSPMLEIKSYCSYVAQILNNL 290 honey bee
EFN79101            214 FLQLLAHINPEMTAANIPKLITIRSSYENRKNVGLSLLWAWSQAGRKNLAVGLKIWHELMSPMLDMKGYANYVVQILNDL 293 Jerdon's...
EGI61868            214 FLQLLAHLNPEMTAANILKLINIRNSYENRKNIGLSLLWAWSQAGKKNFAVGLKIWHEVMSPMLETKSYASYVVQILNDL 293 Panamani...
XP_002001979        225 VLQLIGQNWPAICSHNMAKTALLRNSYQNRSNICLSILWAIGQGGHQNLTEGVKVWQNLMLPNLELKSLSKFVVEHIERV 304 Drosophi...
EDW28302            220 MLQLIGQNWPSICSKNFAKTALLRNSYQNRSSICLSILWAIGQGGYRSLNEGVKVWQNLMLPNLELKTYSKFVVDYIERV 299 Drosophi...
WGS:AAPP:GF14050-PA 215 LLQLIGQNWPGICAKNLAKTALLRNSYQNRSTICLSILWAVGQGGYQSLNDGVRVWQNLMLPNLELKQYSKFVIEYIEKV 294 Drosophi...
XP_004933467        199 LLQMLAQDNPEFCIASLQKYGSLRNSYQNRPPIGMSLLWAFGQGGLKDFTVGLKVWQEIFLPVLELKNYTKYVIGYLSKI 278 domestic...
XP_005990959        220 CIQAVLQDKPKIATMNLPKYLELLRSHQNRPLKCLSIMWSLGQAGFADLTEGLKVWLGIMLPVLGVKSLSSYAIGYLDRL 299 coelacanth
XP_011490299        299 LLLHANLSKGFGI-MGPKEFFPLLDFAFMPKNS--LSPSLQEQLRRLYPRLKVLAFGAKPeNTLHTYLPSFLSR-----A 370 Japanese...
Q6NUQ4              302 LLMHPNLTKGFGM-IGPKDFFPLLDFAYMPNNS--LTPSLQEQLCQLYPRLKVLAFGAKPdSTLHTYFPSFLSR-----A 373 human
XP_006561802        291 VFGHETFHD-----LKPELYLDIVENICSGKLN--VSASIGREINNSIEKLRSILFKNKN-INYVKLFEMLITK-----I 357 honey bee
EFN79101            294 VFGHDNVRD-----LSLDLYLDIIAETYSNKFSn-QPANLAVEISTSIDKLRSIVFKSKD-ISYTKLFEMLLGK-----V 361 Jerdon's...
EGI61868            294 VFGHDNVHD-----LSLDLYLSIIMDTYSQRFQniQPANLGKDLSASIDRLRSILFRNKD-ICYTKLFEMLMGK-----V 362 Panamani...
XP_002001979        305 LNAAAARK-GEALlINQQEFFDCYNALNGNYNN--FSKEQQASLKRSAKQLLQLYI-ASP-VKQANIFLTLLRL-----I 374 Drosophi...
EDW28302            300 LNAAAVGTSEDILlLNQNEFFATYNALNATYNN--LPKELQQSLKRSASQLLQKYI-SSP-VKHANIFLTLFRD-----I 370 Drosophi...
WGS:AAPP:GF14050-PA 295 LKEASARKLDDPLlLNQQEFFAAYNALNATYIN--LPKEQQQSLKRSARGLLEIYI-NSP-VKHANIFLTLFRD-----I 365 Drosophi...
XP_004933467        279 IDHHSEMNTIN---VNQDQFFSMIDLINTKKNG--LSKEFSGDLIKQLSKYKDIYFKKSG-NKLQVTFNQLMKKlpnqyL 352 domestic...
XP_005990959        300 LMMHPNLTKGFGM-IGPKDFFPVLDFAFMPNNS--LSASLQEQLQHLYPRLKVLAFGGKPeSTLHTYFPSFLSR-----A 371 coelacanth
XP_011490299        371 TPSCPDDMKRELLSSMTECLAVD--VQSLGVWRQLYTKHLPQSSLLLNHL-----------LKSWNALPP-KLR-TNLEE 435 Japanese...
Q6NUQ4              374 TPSCPPEMKKELLSSLTECLTVD--PLSASVWRQLYPKHLSQSSLLLEHL-----------LSSWEQIPK-KVQ-KSLQE 438 human
XP_006561802        358 TQKIHANYRDELIKALVTCLATD--SLCFSVWKSIYAKNLYQSHLILSYI-----------DSKWHVLHA-TLEiKCLKE 423 honey bee
EFN79101            362 TPKSYTDYRCEIIKALADCLVTE--PRCFAIWGSIYPTYLYQSSLLLQYI-----------DANLPSLQP-QLRtKHFKE 427 Jerdon's...
EGI61868            363 SQKLDLNYRNELIKVLADCLVTE--PVCFTIWNSIYTKNLYQSSLLLSYI-----------ETNLPSLQT-KFKaKHFKE 428 Panamani...
XP_002001979        375 NS----NNQRTEIEGCISCLLSSgaDDCFKVWRMNYKKQQIPSCILLMAI-----------VNDWEGPAKaLAQsPAFLS 439 Drosophi...
EDW28302            371 TTV---NKPINEIEGCISCLLSSggDDCLKVWRMNYKKQQLASLLLLQAI-----------DKDWETSTNlLAKsPVYHT 436 Drosophi...
WGS:AAPP:GF14050-PA 366 SAT---SKNNNEIEGCIRCLLSSgrDDCLRVWRMNYKKQQVPSLLLLRAI-----------NENWAGSTKdLALsSAYHS 431 Drosophi...
XP_004933467        353 SGSALDPYNKVIIESLVDCLSKD--DSCNATWRQLFHR-----------CskqsaslldfiDSNWLEVSK-KLKlKSLKA 418 domestic...
XP_005990959        372 TPNCPEDMKKELLNCMSECLNMD--PLSFSVWRQLYTKHLSQSSLLLNHL-----------LESWDSTSR-KMQ-KSLQE 436 coelacanth
XP_011490299        436 TIRSFRVTNEEMKEVVES--EELQECNKLCQNLQVKMRGNS----------------FPWVKLLLVLSVFAAGFIAHDIR 497 Japanese...
Q6NUQ4              439 TIQSLKLTNQELLRKGSSnnQDVVTCDMACKGLLQQVQGPR----------------LPWTRLLLLLLVFAVGFLCHDLR 502 human
XP_006561802        424 TCIVFQTINERCKKTKDE--GLANNCSKLCKVLLLKMTASAnk-------------kFPWKKGIILLLLFISVILGYDIY 488 honey bee
EFN79101            428 TLAIFQNSNEKWKKVKDE--NLANTCKVTSQALLKKMTSSTrr-------------gFPWGIGSLSLLLLISAVIIYDVQ 492 Jerdon's...
EGI61868            429 TLGIIQNNNEKWKKAKDE--NLALTCKKTSQALLKKMTSSSr--------------gFPWRSASLLLLLLIGAIVAYDTQ 492 Panamani...
XP_002001979        440 FLQSVKHLNIELQSNKRKd-ICVDDLEAILKTVQEKTSAQQkknkqnaasqkkkcgcCKWTLGSIFIIALIAGALCYDTE 518 Drosophi...
EDW28302            437 FLHDLRLLNEELQSSKRRe-SCLDELIEVLVTVQEKSSAQQkknkqnsatqkkkcgcCKWTLGSIFIIALIAGALCYDTE 515 Drosophi...
WGS:AAPP:GF14050-PA 432 FLQDLRNLNDELRCSKKRd-STIDSLQEVLLSVQEKSTAQQkknkqnaaaqkkkcgcCKWTLGSLFIVALIAGALYYDTE 510 Drosophi...
XP_004933467        419 TVLQYKEVSGEALKGKKKd-EVLVKTTKICQDILDRMTSTRr---------------NPWLWASFVLLVSIAGLVAYDVS 482 domestic...
XP_005990959        437 TVHSFKVTNEELSAKGQSsvQDIAACNAACNNLLHKMRGRG----------------FPWHQLLLMCLIFIVGFVMHDIR 500 coelacanth
XP_011490299        498 SN--GSVAGSSTAKYLQSSGVTAVSQQAWSKVTVYSKQGFSWLEKNTPHYYSECVRVLGPIARQAAEQSQAVGVLISEKA 575 Japanese...
Q6NUQ4              503 SH--SSFQASLTGRLLRSSGFLPASQQACAKLYSYSLQGYSWLGETLPLWGSHLLTVVRPSLQLAWAHTNATVSFLSAHC 580 human
XP_006561802        489 KH--DDFKASNTNKFLKRSGLFACGQQSWIIMQEYSYKALEFVEATSPEYYKATIETCQPYIKLTGNVYIIIKNHFLKIF 566 honey bee
EFN79101            493 KH--GSFEASQIGIFVKTSGISKYVEKAWTTIQSYSSAGHQTIKNSS-EYYKAAVDLCVPYVKLAGDVYLVVKNISIKIY 569 Jerdon's...
EGI61868            493 KH--GSFKASQVGKFLKTSGILKHVEKAWTTLKFYWSAGHKAVKDSSPEYYKAVVDLCAPYIKLAGDSCLIVRNLSIKLY 570 Panamani...
XP_002001979        519 VNgkGVFENSATGKVLKNAGVLPQVQRGWYVTMGAGARGYKWAEQHIPPY-------AQPAIKTGIDVWKIARNACCSAY 591 Drosophi...
EDW28302            516 VNgkGVFEKSATGKVLKNAGVLPHVQRAWYVTMGASARGYKWAEEHVPPY-------AEPAIKTSVDLWKLARNAAYNII 588 Drosophi...
WGS:AAPP:GF14050-PA 511 TNgkGVFEKSATGKVLKNAGVLPHVEKTWYTVMGAGARGYKWAEVNVPPY-------AEPVVKTSVDVWKLARNAACNIF 583 Drosophi...
XP_004933467        483 RAg-GNFPKSTTGKLFKDLGILEHSQQAWQKTLSTSARGYLWLETNAPVYYAQTVEICRPYTQLSKDAFFIALKKAGILY 561 domestic...
XP_005990959        501 SH--GSFKASSSARMLQQTGVMSVSQQSWNKISHYSQEGYSWLETNAPHYYTQILTTLGPNLEVVWNKTSEAAIYITEKC 578 coelacanth
XP_011490299        576 SQLLLWLRESAPLAIEWVNTNTPDSVFQL-----------------------------LAYIRELLLFiqqnyvlpaaaf 626 Japanese...
Q6NUQ4              581 ASHLAWFGDSLTSLSQRLQIQLPDSVNQL-----------------------------LRYLRELPLLfhqnvllplwhl 631 human
XP_006561802        567 DNILEYIEKNSPLILQTIEHYIPGMLDEIklrsnqgleymkvysnlcveklnehsiatLQWLEHNVFV------------ 634 honey bee
EFN79101            570 NNALVYIEKKTPMVLDTIEHYFPGIVDQIqsrslqalefvkvsfaligekviehssaaVEWLGKNVFV------------ 637 Jerdon's...
EGI61868            571 NNVAAYVERNVPIIIDTIEHYAPGILEQIksrslqglefvkvsfiligekviehssasIQWLEKNVFV------------ 638 Panamani...
XP_002001979        592 TNALNYWRSQWPAVAKFIDQYLPNFSHKLeafaagakd-----------lavnsydksATLIKEKVLV------------ 648 Drosophi...
EDW28302            589 QSGKGYFNTKWPVLAKFIDQYVPNLSSKLeafvsgacd-----------lannsyeksAALIKEKILI------------ 645 Drosophi...
WGS:AAPP:GF14050-PA 584 QNGKGYFSAKWPVVAKFIDQYVPNLSGKIeafaagvsd-----------favssydksATLIKEKVLV------------ 640 Drosophi...
XP_004933467        562 GNVQDYVVEKTPVVIKTIEEYAPGLVDNVqsyastawsgl-------kkyssdyyqitTDYLVTKVFV------------ 622 domestic...
XP_005990959        579 SAQITWIKENFPRFIEWLHASLPDAALHF-----------------------------FQYIKELLLFihqnyllpvkey 629 coelacanth
XP_011490299        627 vsellqrawsslqdscnGEVSVSCLQDHALSFTNSTwqllQHTTSAIKTWAQE 679 Japanese medaka
Q6NUQ4              632 llealawaqehcheacrGEVTWDCMKTQLSEAVHWTwlclQDITVAFLDWALA 684 human
XP_006561802        635 -----------------GKLSPENLQNYASKAIDTT----QTLASQTYDWVYE 666 honey bee
EFN79101            638 -----------------GKLSPENLGDYAVWTMRTT----LSYASETYNWVYE 669 Jerdon's jumping ant
EGI61868            639 -----------------GKLSPDNLRNYAIWAFDTT----QSYAAQTYDWVYE 670 Panamanian leafcutter ant
XP_002001979        649 -----------------GRFSPENINQ----AFNQT----RNAALEYYNQFHK 676 Drosophila mojavensis
EDW28302            646 -----------------GRFSPENINQ----ALNQT----RNVALEYYNQFHK 673 Drosophila persimilis
WGS:AAPP:GF14050-PA 641 -----------------GRFSPENINQ----ALNQT----RIAALEYFNQFHK 668 Drosophila ananassae
XP_004933467        623 -----------------GDWAPEVLQNKTQSALNMT----KSQVSSYYVWFRQ 654 domestic silkworm
XP_005990959        630 iqtgieqawkrfvdsckGEVSWPCVNQHLMNITQSTwaylQNTTISVKNRALA 682 coelacanth
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap