Conserved Protein Domain Family
zf-C4H2

?
pfam10146: zf-C4H2 
Zinc finger-containing protein
This is a family of proteins which appears to have a highly conserved zinc finger domain at the C terminal end, described as -C-X2-CH-X3-H-X5-C-X2-C-. The structure is predicted to contain a coiled coil. Members are annotated as being tumor-associated antigen HCA127 in humans but this could not confirmed.
Statistics
?
PSSM-Id: 401955
View PSSM: pfam10146
Aligned: 24 rows
Threshold Bit Score: 177.57
Threshold Setting Gi: 341903703
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
XP_001967001  20 AIKDIRDKTLALEKLKVRIIKEVKLSDDEEKCLEEYRKEMEHLLEEKMSHVEELRQIHADINDMENIIKQTKENQTRSFD 99  Drosophila anan...
AAI62002      13 SIKEIRNKTLQMEKIKARLKAEFEALESEERHLKEYKQEMDLLLQEKMAHVEELRLIHADINVMENTIKQSENDLNKLLE 92  Norway rat
XP_002113013  18 mVRGIRNKVQLLDKLKSKMQKELELISGEEKKLQEFTSEIELLQEEKMNHVEALRLIHADINSMEAIIKQTDQECHQCRN 97  Trichoplax adha...
EGT59635      25 KVANAKTKVADYFAKKNELYEEIDELKNTENFIKETAKTIDELNKEKEEHSEIILLINQDKSDLEREIAEAESERKERED 104 Caenorhabditis ...
1_pfamImport   1 KVQNARSKYDDYNSKRNELLEEIGELENTIKFIKETSKTIDELNKEKEEHSEIIQLINQDKHDLEREISAAETEKKEKES 80 
CAP23824      29 KVANAKTKVDDYFAKRNELLEELSELENTEKFIKETAKTIDELNKEKEEHSEIIQLINQDKSDLEREIAEAESEKKEREG 108 Caenorhabditis ...
EGT59638      35 NIGKLRNGIDEFHKLADEIRKEEEAVKALEHHIANCNGVKTELDLERRNHAEELRQINQDINSLEDITKSTNSEIEKRKR 114 Caenorhabditis ...
XP_015788909  24 CLKELRDVTLELSKKKARLHSALEAMDEEAKCLETFKNEKALIEQEREAHCAELLLIRDDLNQMESVIQESESETDHHLA 103 two-spotted spi...
XP_015790456  21 YLKELRDVTFELNSIKSRLKQEMDSMEAEKRCLLAYRKEKEFLEQEKTAHVEELRLIHSDLNQMENVIKESDEEHSQHLA 100 two-spotted spi...
XP_015781488  24 YLKELRDVTFDLNSLKSRLKQEIETMESEKNCLSVYRKEKEFLEQEKMAHVDELRLIHSDLHQMESVIKESEEEHNNHLN 103 two-spotted spi...
XP_001967001 100 MANRVYEEYLALKYQIDHMRRDYLGLSPLRDLHEEEGSPISKERFQTNFlkaaaaaaaaataasvtqptslarpharhpl 179 Drosophila anan...
AAI62002      93 STRRLHDEYKPLKEHVDALRMT-LGLQRLPDLCEEEEKL-SLDYFEKQK------------------------------- 139 Norway rat
XP_002113013  98 NIQRTHKEYNELKYEVDKMRSS-LGLESLPGLEDDDRNLFT-GIMKAQEts----------------------------- 146 Trichoplax adha...
EGT59635     105 KIKKKYEALLKLMEATNEKLKE-TGCD----ISLNQDDLPKTHI------------------------------------ 143 Caenorhabditis ...
1_pfamImport  81 KIVRKYEILLKLMEQTNDRLKE-SGID----VAINQDDLPQTNL------------------------------------ 119
CAP23824     109 KIVKKYELLMRLMEATNEKLKE-TGCD----IALSTDDLPQTHL------------------------------------ 147 Caenorhabditis ...
EGT59638     115 KITSVMAEVDRMRSFINENLESMNIIHKLES--SEEEELFKETV------------------------------------ 156 Caenorhabditis ...
XP_015788909 104 MAKSLILEWQKLADRANKIRSA-LGLNQLPNLPEEEK--LKEDIIKSTGsedgahhhamafeqdnafkp----------- 169 two-spotted spi...
XP_015790456 101 TAKSLLIECQQLKDHANKMRSG-LGLGLLNDLQDEEEK-IRLELFKKHQlnessnrdfeand------------------ 160 two-spotted spi...
XP_015781488 104 AAKSLLQEWQQLKEHANRMRTE-LGLNRLSELSDEEDK-IKHELFKGQHvtnhvhsnnesint----------------- 164 two-spotted spi...
XP_001967001 180 mpeatvttlpnaggagggaagaggggagalgggscgglgyekltfmraaetyapraaiaraavVRLGKGDFSAPPPPP-- 257 Drosophila anan...
AAI62002     140 ---------------------------------------------------------------AEW---QTEPQEPPI-- 151 Norway rat
XP_002113013 147 --------------------------------------------------------------kIIH--TEVKPPLPLA-- 160 Trichoplax adha...
EGT59635     144 ------------------------------------------------------------------KIELSTTPAPPIf- 156 Caenorhabditis ...
1_pfamImport 120 ------------------------------------------------------------------KIEPSTAPATPVl- 132
CAP23824     148 ------------------------------------------------------------------KIEPPTSPVTPVi- 160 Caenorhabditis ...
EGT59638     157 ------------------------------------------------------------------ERQSCNPPAPPA-- 168 Caenorhabditis ...
XP_015788909 170 -------------------------------------------llmianqqpmqqqpylfpspTSSSSRDFQSVGPHSpg 206 two-spotted spi...
XP_015790456 161 ---------------------------------------------------kqlnkpllsiatNSH--SSSITPFKPTlp 187 two-spotted spi...
XP_015781488 165 --------------------------------------------------nlmmnksmlsmssNAP--HSYLNPVPPTaa 192 two-spotted spi...
XP_001967001 258 ------------PPSNRLQ----------------------QSPSIgi------gHHPSFRsdfnvnlrQQP-------- 289 Drosophila anan...
AAI62002     152 ------------PESLAAAaaaaqqlqv--------------------arkqdtrqtATFR--------QQP-------- 183 Norway rat
XP_002113013 161 ------------PPTAIDTvtplqav---------paenqdEEPVI-----------QQFK--------QQA-------- 192 Trichoplax adha...
EGT59635     157 ------------G-GGLPSpfpninfkhlfqpmfleqlggfPANPAaqqfrhpphVAAAMQqhqr-vtdHQS-------- 214 Caenorhabditis ...
1_pfamImport 133 ------------S-GGLPSpfpnfnfkqlfqpmfleqlggaFPSTPptqfrppphMAAAMQhhqlkvtdHQS-------- 191
CAP23824     161 ------------STGGLPSpfpnfnfkqlfqpmfleqlggfGQNPPpaqfrppphMAAAMQhqqmrstdHQS-------- 220 Caenorhabditis ...
EGT59638     169 --------------------------------------------MVpdvprvpsdIPAFLQsllncaqqQQPgpgnmssi 204 Caenorhabditis ...
XP_015788909 207 mgmsslmnphhgPPSGLMSsgsssnl------------------------versqnrSSFC--------QQP-------- 246 two-spotted spi...
XP_015790456 188 s--------iplRPGLLQGpssahssvts--gvssisvserQAPPA------------AFR--------QQP-------- 229 two-spotted spi...
XP_015781488 193 rtf-----kqnlTGSRINPisgpashqfs--atpsnsiserQGPPA-------------FR--------QQP-------- 236 two-spotted spi...
XP_001967001 290 ----------PP-------MKSCLSCHQQIHRNAPICPLCKAKSRSRNPKKPKKK 327 Drosophila ananassae
AAI62002     184 ----------PP-------MKACLSCHQQIHRNAPICPLCKAKSRSRNPKKPKRK 221 Norway rat
XP_002113013 193 ----------PP-------MKMCLSCHQQIHRNAPICPLCKAKSRSRHPKKKRKi 230 Trichoplax adhaerens
EGT59635     215 ----------PP-------MKQCQSCYQQIHRNAPICPMCKCKSKSKNPKKPKRK 252 Caenorhabditis brenneri
1_pfamImport 192 ----------PP-------MKTCQSCFQQIHRNAPICPMCKSKSRSKNPKKPKRK 229
CAP23824     221 ----------PP-------MKTCQSCFQQIHRNAPICPMCKSKSRSKNPKKPKRK 258 Caenorhabditis briggsae
EGT59638     205 prnmmnrhrmPPsfveaskMKVCENCGANIHRNAPTCPVCKMKTRSKNPKKKIRR 259 Caenorhabditis brenneri
XP_015788909 247 ----------PP-------MKSCLTCFQQIHRNAPICPNCKAKSRSRNPKKPKRK 284 two-spotted spider mite
XP_015790456 230 ----------PP-------MKSCLSCHQQIHRNAPICPLCKAKSRSRNPKKPKRK 267 two-spotted spider mite
XP_015781488 237 ----------PP-------MKSCLSCQQQIHRNAPICPLCKAKSRSRNPKKPKRK 274 two-spotted spider mite
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap