Conserved Protein Domain Family
YukC

?
pfam10140: YukC 
WXG100 protein secretion system (Wss), protein YukC
Members of this family of proteins include predicted membrane proteins homologous to YukC in B. subtilis. The YukC protein family would participate to the formation of a translocon required for the secretion of WXG100 proteins (pfam06013) in monoderm bacteria, the WXG100 protein secretion system (Wss). This family includes EssB in Staphylococcus aureus.
Statistics
?
PSSM-Id: 401949
View PSSM: pfam10140
Aligned: 17 rows
Threshold Bit Score: 380.067
Threshold Setting Gi: 451783091
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q2G185                35 IPKSSIKPEHFHLMYLLEQHSPYFIDAELTELRDSFQIHYDINDNHtPFDNIKSFTKNEKLRYLLN-IKNLEEVNRtRYT 113 Staphyl...
EIM56717              47 LKKSALNASTEYDYRFLTYKNELLLPAQIHPEGEEIHITYQTGDRN-PFASAVTEDLPERIQLLIS-CAALAQLLE-EYS 123 [Eubact...
CDF07299              12 MKKSSLRADNIFEYEYLMKETRGLLPCHITEEGEDVRFEFDLTGMH-PLSELKKEEMEYRLRFLQN-FYEIYRIWT-EYD 88  Firmicu...
goetting:Cspa_c02410  10 LKISDLKAKNSIEINRIAYEHRYLVPCELDIQEEEVKFIYDLNGLKl-FSEIKNAKLVDKLRVAIN-ISDLFEVLD-EYS 86  Clostri...
Q8DZR4                26 LKRSKVGTQNLQQLQLLEIHHSLLMPMTTAIDADTIQFQFQTEAHAlFFESFKKETLSEKLRLALN-VLDLDKALSlSVN 104 Strepto...
CCO10668              27 LKKSDAQLRNEEEITLLLEAKKEFLPLSVQVEEDAFIFHFEPLALGlDYSEVMLKSQAEKIRAALN-LAVFEKYVGsYYT 105 Carnoba...
Q8YAQ6                25 FPKSKTRAKELAQLELLEKPATHFTPAKISSDSDSYTISYEIAPRTyGFEQVRKMGREDKLRALRN-IADLGELLNtRYT 103 Listeri...
Q813N5                26 MTKSQTRIKDFRQFDIITGESSEFVPLTIEETDDMFTFLYQVDKKLyKWGDLSRFGRNEKLRLLRN-VAQFRKYLNkRIT 104 Bacillu...
Q8ERI7                26 LPISQTRMKNLRQLDLMLQPSEFLVPLEIKEEEDTIHFDYKLHPKRkSWTKIQKLNHNEKLRILCN-LGKLDRFLTsRIT 104 Oceanob...
BAK15726              28 FQREKIKLANELEITLLQENNPFI-EKNITLTEDELIFTYKKEPNFmTFGKLRTLDERSRWMFASKvLRFIMLHQSnRLH 106 Solibac...
Q2G185               114 FVLAPDELFFTRDGLPIAKTRGLQnvVDPLPVSEAEFLTRYKALVICAFNEKQSFDALVEGNLELHKGTPFETKVIEAAT 193 Staphyl...
EIM56717             124 FSLEPSNLYYDAQYRTVVKMRDIY--AAGVQTSEEDFCRQYRALIGFVLQKKYSYMDYLQGGEQLLAESRFLSGLLNLHT 201 [Eubact...
CDF07299              89 LPLTEENIYYDRNYVPYIVFRDMKq-LKKEDEEEYEFRNAYQELAVGILGNKYSYTQVRESGLMIAAKDKALGYILACKT 167 Firmicu...
goetting:Cspa_c02410  87 FDLNPNNLYCDYNFNVKILGRDIK--LEEEIINYEEMVLEYKSIIGYIFNYEYSYDDFYNGGLDLIKANKHIKKYALLNS 164 Clostri...
Q8DZR4               105 FILHPSNLFLTKNATAKIAYRSLPgiMRPEKFGPEEFLYQFKCFVFALLT-QHDYIELYNGAISVIEVSDFLKSIYHAET 183 Strepto...
CCO10668             106 FFLDPENLQFDVNLVPYIAYRGLKsgLPPAELTAENFLRQYKSIVIALFSKKQTFSSLYGGNLERAKESNFIKTIANAKS 185 Carnoba...
Q8YAQ6               104 FFLHPDNLIFDINLVPSIVHRGIKniLPPYELTEETFFKQYQCFVIAMFSKKFSFENLYNGSLSGARGTQFEKSILDAKT 183 Listeri...
Q813N5               105 FFLHPDNIVFNANLIPSIIHRGIRdiVPPTPLLEEQFLTQYKCLIIALFSQKHNFDDLYAGLLKDAKETTFEQTVAQMES 184 Bacillu...
Q8ERI7               105 FFIHPDNVVFDDNYLPSIIHRGIRdvVPPFDMQEEAFLKQYKCFIIALFSKKYNFEQLYYGSLEKANETEFEKKVQQLTS 184 Oceanob...
BAK15726             107 LIVCPENILIDESLTAYFLHSGVKesIPPYERNKERLWAETKAIIAAAVQPKYKFDQYIQFSKSI-ELSPVAVKIMEAKD 185 Solibac...
Q2G185               194 LDLLTAFLDEQYQKQEQDYSQNYAYVRKVGHTVFKWVAIGMTTLSVLLIAFLAFLYFSVMKHNERIEKGYQAFVKDDYTQ 273 Staphyl...
EIM56717             202 VEEIRQYLLTEYLRVKKDRRGNYELFPKKAHKALKIATVSLSVLLAAAVGFIAYHMFFVEPYKDAEIGLSRAYTKSEYET 281 [Eubact...
CDF07299             168 TEEMYKEIGERAEQIHRENSEEKIRLDKRKYETGKKILAGILCVFILALFYMGYQTFVILPRDQAVIRASRAYMVQNYVE 247 Firmicu...
goetting:Cspa_c02410 165 IKEIRDELLVELQEQERNQRENYIEIKLRSLKIRKYSIVGMSIIILGLLVYMIYNSIFLNPYYLNIIKANNYYMTKDYEG 244 Clostri...
Q8DZR4               184 IQAVRDIITIDYEQQVEVETHTLAKVSRAKYKLYKYISVWLGALSTILLIPLVYLVFIHNPFKEKMLAADTSFIKVDYNQ 263 Strepto...
CCO10668             186 VKEITDYLEKEYQGTIAADEKNLRVVSKRKFMTYKQLTIWFSVAIIILLIPLVYLVGFNNPHQAKLLKADTAFLKNDYEQ 265 Carnoba...
Q8YAQ6               184 VQDIATILEEAYMKEHAAVQKNMASVPKKKYSTFRGLAVGFIIVAILLAIPVSYFAFVKVPLQNDLLTANENFLKTDYDK 263 Listeri...
Q813N5               185 LDALLQFLDDSFEKEQTKTEKNMQLVPKKSYKSFKYLAFSFIAATVILAAPLIYFTFIKFPYQNKLLEANASFIATDYDK 264 Bacillu...
Q8ERI7               185 MEALKEFLIESYEIEQEKTEKTMSFVPTKRFRLYKQLSIIMIIVSVLLAAPLIYYALINHPFQDKQLDAYGEFLGDNYNG 264 Oceanob...
BAK15726             186 EQELLTIIQDQLQLLEKE-VKKYTKIAKTKWNWVRYSLMGLLLVLLPLGIYTGYAALVIQPQQEAYVAVQAPYIQGNYSE 264 Solibac...
Q2G185               274 VLNTYDDLDGKKLDKEALYIYAKSYIQTNKqgLEKDKKENLLNNVTPNSNKDYLLYWMELGQGHLDEAINIATYLDDNDI 353 Staphyl...
EIM56717             282 SIRAMEKVSVSRMSDVEKYMLATAYVRTED--LTSEQKENIIETFSLNNAPERMEYWIYTGRNQTEEAVDIGIRLSDGQL 359 [Eubact...
CDF07299             248 CIDELQNMQTDQMDTYTKYILASSYARCEA--LEKTELENVLKNISIYSNEAELGYWIAIGRSDFTQAENYAKALSDDKL 325 Firmicu...
goetting:Cspa_c02410 245 VIKSLESTRGLKLDKESKYKLAYSYIISEN--LSDAQKKNIIANLDAKSDENILDYWIALGKSKYDEAIDLSKKLQDDEL 322 Clostri...
Q8DZR4               264 VINRLEHVKVSKLPYTQKYELAYSYINGMS--FSEEQREVILNNVTLKTDELYLDYWINIGRGLDDDAIDAAKRLDDSDL 341 Strepto...
CCO10668             266 VIQTLQPIATDKIDATQKYELAYAYVQGKD--LSDKQKAIIMKSISLKSAPTYLDYWIENGRGNLDKALEHGKRLEDNTL 343 Carnoba...
Q8YAQ6               264 VITGLENVDPEKMPQSVQYELAYSYVKGEK--MSDKKKENIMNTISLKSDAKNLLYWIYNGRGEFSKSLDIAKLLDDPTL 341 Listeri...
Q813N5               265 VITQLNEEEFESLPIASKYELAFAYITAEK--LGEAQKKSIMKNISLKSDEKYLLYWMYNGKGNFDKSLDLAKTLDDPQL 342 Bacillu...
Q8ERI7               265 VITTLSDENPENFPSQTKYMLAYSYIQVES--LPDEQKNSILNNVSLNSNQDYLLYWIYNGRGNFEESLEKAKYIDDPQL 342 Oceanob...
BAK15726             265 IIDQLAQYDVEKMPNVIQYELSLAYIVNET--LTEEQKENVLKTITLQTDPDYFKYWIYIGRGQAEEALTVARQLEDLDL 342 Solibac...
Q2G185               354 TKLALINKLNEIKNNGDLSNDKRSEETKKYNDKLQDILDK 393 Staphylococcus aureus subsp. aureus NCTC 8325
EIM56717             360 QLYAYMKAKAVTEADTSMDAEKKKDMLEKLDKKIEELSKE 399 [Eubacterium] cellulosolvens 6
CDF07299             326 LIYSYMKELNYLEGNINMDGEEKQNRMNELGNAITEISSK 365 Firmicutes bacterium CAG:95
goetting:Cspa_c02410 323 TLYALLNKDKYIQDNNKMTGEEKQKEKEAIKSEIDKLTKE 362 Clostridium saccharoperbutylacetonicum N1-4(HMT)
Q8DZR4               342 VIYAIVQKMDQVRKDNSLSGKDREQKLSELQTDYDKYWKD 381 Streptococcus agalactiae serogroup V
CCO10668             344 ILYGLQQKIEQIKNNPDLSGAEREKQLGDAEADYQKYQEa 383 Carnobacterium maltaromaticum LMA28
Q8YAQ6               342 AMYSLTKQIEQVQSDTTLSGDEKVEKLKTLEESLKEYDEK 381 Listeria monocytogenes
Q813N5               343 IMYGLVKQIESLKNNPDLSGEERDQKLKTYEQQLDEYKKK 382 Bacillus cereus ATCC 14579
Q8ERI7               343 IIHGLIQNRDQVRNNPDLSGTERDEELNQLQDELDRYLEE 382 Oceanobacillus iheyensis
BAK15726             343 IMLALLHYEESIKADRELDGEDREQLLDKVQTEINEVTKQ 382 Solibacillus silvestris StLB046
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap