Conserved Protein Domain Family
Virul_Fac

?
pfam10139: Virul_Fac 
Putative bacterial virulence factor
Members of this family of prokaryotic proteins include various putative virulence factor effector proteins. Their exact function is, as yet, unknown.
Statistics
?
PSSM-Id: 401948
View PSSM: pfam10139
Aligned: 15 rows
Threshold Bit Score: 1015.72
Threshold Setting Gi: 1388781637
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
ESQ08920                  21 AIDWVRQvRGESARLDRESDSLIDKIRRTRNHVRRLGRAASRPVSVGFFGLSQAGKSYLISALAAGADGELETDLQ--Gr 98  unc...
WP_013066381              20 ALGWLDV-QSNADRVGAEKGSMTRTLRRAVRRAERLGKSARTPMSVSVFGPSQAGKSFLVSVLARPADGRLVAQFGptG- 97  Rho...
Q16BF7                    21 ALAWVNH-AENAETVGPRHKSLTKLLRKSARRAERLGKSARTNMSVSVFGPSQAGKSFLVSVLARPSDGRLTADFNgpGg 99  Ros...
WP_012177574              21 ALDWIGD-AENADQVRGREKTLAQLLRQSKRRAKKLSRSARTRMSVSVFGPSQAGKSFLVSVLARPADGRLTADFNgpGg 99  Din...
jgi:Ddes_1314             20 agqagtwlqDNAGLVGGEKNALLRDMRHAIRFFGKCGQAAERKMCVGVFGPSQSGKSYLISALASDANGTLLADFC--Ge 97  Des...
PRJNA391730:Sp245p_04155  22 ARRWVEEvRASAVSVANEAHGLRAATRRSENLARKLIGAAGRRNCVGVFGPSQAGKSYLVSALARSRSSSLTADFG--Re 99  Azo...
Q9CK17                    22 AIDWIDDvRPNVVRLNNEADSLILELRRLRNTAKRLGAVSDKPITAGFFGLSQAGKSFLISALAADERGKLETLFD--Gq 99  Pas...
CBL44090                  30 AIQWIGNvRASAPRLDSEADHLVLKLRRVRNTAKRLGAVTPRPMTVGFFGLSQAGKSYLISVLAAGANGKLETIFG--Gn 107 gam...
WP_012987698              23 AIEWVEEvRGNAPRLNTEADRLKLKLRRSRNTAQRLAKAATHPMTIGFFGLSQAGKSYLISSLAAGENGRLETQMG--Sy 100 Xen...
CDK97433                  22 AIGWVAEvRPGAQRLDRDADGLIERLRRSRNLARRLGQAAKRPMSAGFFGLSQAGKSYLISSLARGDNGRLETVLD--Ge 99  Mag...
ESQ08920                  99 hLNFIQHVNPPGhGKEATGLVTRFTRQPV-AAPPGYPLELTLLSEADLAKVLGNAFFHDFDREQVDw-dLGSFHIRAHIR 176 unc...
WP_013066381              98 -LDYISELNPEG-EGESTGLVTRFTCTRP-EVPAGFPIRLSLLSEADLARVIANSFFMDGDKSEPP---PEPADLTAHLD 171 Rho...
Q16BF7                   100 qLDYISQVNPAG-DGESTGLVTRFTMTKA-ATPDGFPIQLNLLSEADIARTIINSFYEDGDQSETP---PEPEDLKAHFA 174 Ros...
WP_012177574             100 kLDYISEINPEG-EGESTGLVTRFTMSKD-PTPEGFPIKLTLLSEADLARTIANSFFNDGSDEEPV---PDAAQMAAHFD 174 Din...
jgi:Ddes_1314             98 sHDFLKKINPEG-GKESTGLVTRFTTSQPeGLSPEFPIRLRLLSETDVARVLANTYYADCDHQDA----PAAEALVKALD 172 Des...
PRJNA391730:Sp245p_04155 100 rRDFLTEINPPG-DRESTGLVTRFTVHRDgPVDPDHPVELRLLSETDLVKILANSFLSDFDPNNMTvklPDEAEIRQVLA 178 Azo...
Q9CK17                   100 kLDFIKHINPPGgGKEATGLVTRFTRKET-KGVAGYPLELRLFSEIEVAKILVNAYFNDFDKERVEy-eITQSRINQLVK 177 Pas...
CBL44090                 108 rLDFIDHVNPPGgGKEATGLVTRFSRTAT-AGPSDYPIELRLFSELEIARILANSFFKDFNVEKFQy-eYSEAKIRQTIK 185 gam...
WP_012987698             101 qLDFLEHINPPGgGKEATGLVTRFSRHVR-PSNPDWPIELQLFNEAEIAKIFANTFIHDFNQEKIDw-nYDEKRINTLLT 178 Xen...
CDK97433                 100 rLDFIDHINPPGgGKEATGLVTRFTRKQP-ITTHGYPVLLSLLNEADMVKILGNSFFLDFDRERANf-dIPQETILARLK 177 Mag...
ESQ08920                 177 ALEAKRQRQ-PVAGLDADAVVDLLEYFEHRFPK--TTARL-KGDFWPSAIELAPLLAPADRATLLSVLWGEVPELTQTYL 252 unc...
WP_013066381             172 TFQTRRQPQ-PLPGMSDEDVIEIAEYIETNFARqsSYAAA-LKSFRDPAAALAPLLAPEDRAEFLSVFWGRHAPMTQLYR 249 Rho...
Q16BF7                   175 AHAGKAGAG-EVPGLSFEEVYEIAEYVENTFGKvaYASHL--RGFWDEAASLAPNMSIKDRGDFLSILWGGYQPLTDLYV 251 Ros...
WP_012177574             175 AHRGRVGSV-DVPGMTEDEVFEIGDYFAASFGR---AAAS-YKPFFEEAAAMAPKMALPDRAAFLSILWGGHEAFTRLYL 249 Din...
jgi:Ddes_1314            173 AIEAAAPAApVADGLSVDDVEDLRDYVNKNFSSrpRVQML-QNGYWTRAAALAPRLDTAGRVRLFGLIWDEVEEFQSVYL 251 Des...
PRJNA391730:Sp245p_04155 179 TAEAEAAGT-PAAHLDEIALYDLGEYFQRNFAA--RIRALdNTDYWEGVIRHAARLTLAGRARLFAMLWGNLGAFTDLFL 255 Azo...
Q9CK17                   178 SLSGRVSAN-LVPGVNQDDVVDLQDYAQDSFGK--SLSVL-QGNYWANATALAPYLAIQERATLFSILWGEIQELTDIYI 253 Pas...
CBL44090                 186 ELTKKSQHQ-PVSGVTEDDVVGLWDYLKDRFPS--SLKML-DVCFWPEAVSLAPYLSLEDRGRLFSVLWGEIPEFTETYS 261 gam...
WP_012987698             179 SLNERRQAY-KVPGVAEDDVVALWDYLIRHAEK--SQSKM-ALQYWPAAVELAPWLSIDDRAQLFGELWGNIHEFTEAYR 254 Xen...
CDK97433                 178 ELQGRRQAK-PTGGMDEDDVVDLSDYFDRRFKK--SNEPL-AGLFWPTAIGLAPYLLPADRARLFALVWGELPEFTDAYA 253 Mag...
ESQ08920                 253 HLRAGLATLGHASAVFCAVDALVREDdqgrltqaDSIMNVDILE-RLGRDHA--DRIGLVPRDgqnadGSAVALPRSLLA 329 unc...
WP_013066381             250 ELAGSLAQIGHPEEIHVGLEAVVPRE--------SSILDVKTLS-DVLSPATgaQTIEVLTGA-----GLRAKLPRARIC 315 Rho...
Q16BF7                   252 KLSSALTLIDNAEEVYAPLEALQPRE--------TSIIDVNTLG-GLFGPENe-DTLPIRTPS-----GKVAQMNRAVVC 316 Ros...
WP_012177574             250 QLAEALARIDGAAEVFAGLDALTPRE--------TSIIDVKTLH-GLFDGAAa-DTLQVRTPG-----GKVVALPRAEVC 314 Din...
jgi:Ddes_1314            252 QLCDALHSLGNPAEVNCPLEALIPRE--------RSIIDVERLR-GLRQSTD--DMLPILAPN-----DRTVSLPRAVVT 315 Des...
PRJNA391730:Sp245p_04155 256 TLAGALERLSHAPDARAALTALVPRE--------TSIIDVEVLKrGLGTPEDarDLVSVRPLAgg-tpGIPVALPRATLT 326 Azo...
Q9CK17                   254 QFAHSLARLGHPERVYAPLSAVVKETpegglsqaDSIMNVDMLE-RLGTARD--EQIDVRPAQge-evGGEVTISLAELT 329 Pas...
CBL44090                 262 MFARVLAQLGHPERVFAPLDVLVSKTpqgglsqaDSIMNVDMLE-RLGRSID--KAVQVRPEVds-elQAPVSLSLAQLA 337 gam...
WP_012987698             255 RFAHTLQRLGGASVVRAPLNVLVTEQngrl-vqtNSIMNVDMLE-RLNKSND--LQITVCPERen-glAAPVSVSLAELT 329 Xen...
CDK97433                 254 KLRQFLQSLSFATEVHAPTSALVEQTggvy-sqsNSIMNVDAVRvRFGTDTD--DLVGVLPVVdg-qpLAEIKLQRSILA 329 Mag...
ESQ08920                 330 ALTAELRFVLAGPAStGLLDQVDVLDFPGYRGRLAVAdLGEVRRqleddQV-DPVAQLLLRGKVAYLFERYTDDQEMSLL 408 unc...
WP_013066381             316 ALAAELVLPMRDVPH-PLFATTDLLDFPGARNRFNKA-LEVTLK-----DP-ETLPGLLLRGKVAYLFDRYVENQEITSM 387 Rho...
Q16BF7                   317 ALAAELVFPMAEQPS-DFFAETDLLDFPGARNRFELP-LTKTLE-----NPeEGVTNMLLRGKVAYLFDRYVANQEITSM 389 Ros...
WP_012177574             315 ALAAELVFPMETQPS-PLFAETDLLDFPGARNRFEQP-LAKTLA-----KPeETVSQLLLRGKVAYLFDRYVENQEITSM 387 Din...
jgi:Ddes_1314            316 ALTAEITIFMREKPD-DFFDHTDLLDFPGYRSRYKFTnLREALA-----SKeDMLKELFLRGKVAYLFERYREEKELTSM 389 Des...
PRJNA391730:Sp245p_04155 327 ALVAELKIVMADTPW-PFFQHTDLLDFPGARSRLKLPcLPSDDG-----EKtAQVRELLLRGKIAYLFQRFTEERELTAM 400 Azo...
Q9CK17                   330 ALTAELVFPLMNPTRvPAVERVDLLDFPGYRGRLAITsLAEVK------EG-NPVSQLILRGKVAYLFERYTDSQEMNIL 402 Pas...
CBL44090                 338 ALTTELVFPLVERTSePLFEEVDLLDFPGYRGRLKVEsLEDVRRqvksdEA-NPVAQLFLRGKVAYLFERYTDSQEMNVL 416 gam...
WP_012987698             330 ALTVELHVPLLSSTReRLFEEVDLLDFPGYRGRLGVEsLNYLQNtaesdDS-NPLAQLILRGKVAYLFERYTLNQEMNVL 408 Xen...
CDK97433                 330 ALTKEMVFGLAEAPRvDLLEELDLLDFPGYRGRMGLTaVAQAAAt---dEGsDPVGTLLLRGKVAYLFERYTDDQEMNVL 406 Mag...
ESQ08920                 409 VLCAPSHKQsDVKDLGPVLETWVHATQGASPEQRARRPAGLIWALTMFDMRLAPAPGQTEDlmRKGW--EGMMKLALLER 486 unc...
WP_013066381             388 LLCVPDSNM-ETVDLPRLVSTWIERTHGARPDQRALVDCILFFVLTKFDKHLGDNAAAGGE--ASRF--QRRMEASLLEK 462 Rho...
Q16BF7                   390 LLCVPDSNM-DTVSLPGLVENWISMTHGATPQERAKNDCILFFVMTKFDKHLGESASGGSS--TERF--ERRMDASLLKA 464 Ros...
WP_012177574             388 LLCVPDSNM-ETLDLPGLVENWIGMTHGVRPADRAETDCILFFVMTKFDKHLGESAAGGGE--ATRF--ERRMDASLLQP 462 Din...
jgi:Ddes_1314            390 LLCIAPGPQ-EVHDLPHAVYEWICSTHGEKPSSRAGKDPALFFVLTKMDMEFEKK--KGSPsvETRW--TTRLESSLVKF 464 Des...
PRJNA391730:Sp245p_04155 401 LLCMPPSTA-EVKDLAPMVRGWIDVTHGATPEARARARTALFLMLTKFDLEFVEKGGETAEsrRGKW--DRRLGASFLEL 477 Azo...
Q9CK17                   403 IVCTPSTKQsDVNSVGPVLERWIHKTQGESPEQRAERKPGLLWAITMFDMRISQDLTKEEEllKISWgsGGLLKQTILER 482 Pas...
CBL44090                 417 IVCTPSNYQsEVTEVGPVLTEWIARTQGATPEIRSRRSPGLLWAITKFDLRIADLLPKTEDnlRIQWgaGGMMRMTMLER 496 gam...
WP_012987698             409 VVCTPSNEQsNVKDVGGVLDEWIRYSQGADADSRARRPAGLVWAITKLDLRITQELTKSEDmlREVWgqGGMIKIAMTER 488 Xen...
CDK97433                 407 VLCNPSDQQiNITALGPVLDSWVAATQGTSPAERARRAPGLLWALTMFDKRLGDSLNQSDSnlEMKW--DGMLTLALLER 484 Mag...
ESQ08920                 487 F-GG--YDWLNEWTPGRAFDNLFLVRKPRMAN-AVMETDDAG---EGPLLPAQVQRLQLLRQTFCADPAVQKHLADPAAA 559 unc...
WP_013066381             463 F-SNgsDNWVDSWAAGRPFQNCFWLRNPNFYVdGLIDYDDDRr--ELRIRPEKAARIAELRQGCLEATAVRRHFADPEGA 539 Rho...
Q16BF7                   465 F-GKlrDSWVHKWTPSQPFQNCYWLRNPNYFVeGLINYNEDEt--EKEIRAEKLDRVAELKEGCLSTDAVRAHFKEPEVA 541 Ros...
WP_012177574             463 FgGKidDSWVNQWTPNQPFQNCYWLRNPNYFVeGLIEYDENQr--ELGIRAEKQARVAELKAGCLAADPVQRHFAEPEAA 540 Din...
jgi:Ddes_1314            465 F-GQv-HDWPENWDGIHPFSNVFLLRNPNFTCeAIFDYTGGR---ETGIRQDQTAFVEEVRQAFLQSPLVQRHVAGAEKV 539 Des...
PRJNA391730:Sp245p_04155 478 Y-GK--DGWPENW-DGKPFANTLFLRNPGMKQlHLMDYVDQQrlvEAGPSAAQADVIAEYRAAFENSPLCARHVADRGIV 553 Azo...
Q9CK17                   483 F-GN--YDWFNNWANGNPFDNVFLVRKPGFKV-PFLNVE-GEn--EVSINQSETAQLALLKRTFCQDPDIRKHIAQPEEA 555 Pas...
CBL44090                 497 F-NQ--YPWLQEWAPGRAFDNTFLMRKPRVAV-PFLKVE-GGv--ETGVNTSVAPQLALMKKTFAEDEAVRTHIHDAEAA 569 gam...
WP_012987698             489 F-GH--FPWMQEWQPGRAFNNAFLVRKPCQAT-PFITMK-EGc--EAEFSQETASKLTLMKKTFLEDAAIQRHIASPEQA 561 Xen...
CDK97433                 485 F-GK--APWVQEWSGGKAFDNLFMVRKPGMSK-GIFDLD-DEr--ELAVKADVQADIDRMRATFSNNRMVQRHVAEPGPT 557 Mag...
ESQ08920                 560 WDAMLLPNDGGIGRLADYLHQVACNQAKLERIAEQLDAIVDDLvQHRFAAYYRGEGAAE-VAAKQRLAEGVIAALK---P 635 unc...
WP_013066381             540 WDAALTLNDGGVRYLVEALTRVCKPDQKLRQIEQQLGRVVEDL-LQTLAPHHVADDLHTrIEEKRKSCNAILDDLLvalQ 618 Rho...
Q16BF7                   542 WDAALTLNDGGVGYLTQELTKVCKPESKMGQISAQLDKMTNDV-LGELRDLYVSDDIETrIEEKREAAAQIIDCLEltlQ 620 Ros...
WP_012177574             541 WDAALTLNDGGVGYLTGKLTKVCKPDSKLRQIKTQAEKIIREL-ELELSGFHVSDDFEKrEAEKRLAAAEIIDCLEltlS 619 Din...
jgi:Ddes_1314            540 WQAAMTLNDGGVSLLRDSLRPLCNPELKRQQICVSLDEKKEQL-LARLAPFYRTDDREElRRQKEQLSRTLVTLLAkvaE 618 Des...
PRJNA391730:Sp245p_04155 554 WDAAFKPNDGGVTFLVERLNAVLDPALKEAQIRQRLQEEAAHL-EASLKRFYHADDDASrREREQALNATRVRLNQamkP 632 Azo...
Q9CK17                   556 WDAMLLLNDGGMKRISQYLETIALPEVKAHRLTEQLNERIHHFvENRFASWYQSDGEEE-VAKKRQLANALAKELHpqnP 634 Pas...
CBL44090                 570 WDGMMALNDGGMARMASYLRKVASRKFKLERSREQMEELVHDLvEANLARWYQAEGAGE-VEKKKKLAQEIANSIR---A 645 gam...
WP_012987698             562 WDAMLQLDDGGMRRLADYLGIVAQREMKLERITEQLNETRHELvKGNLHAWYQPDGAEE-VEKKRLISEDILKALQ---N 637 Xen...
CDK97433                 558 WDAMIGCDDGGMSRLVGHLRKVAHVSNKLERIGEQVDHLQRELvEIQLGAYYRADGADE-VERKKRLVEVVLGGLR---Q 633 Mag...
ESQ08920                 636 C-AsRFGDLLSMLPPPRDELRGLYLR------TDRRAPVDRRAPADspes--------vagAFPDQPPADIggglidLDA 700 unc...
WP_013066381             619 Q-H-RFGAVLSALGVDQDAIAENIVRvpssirIGSAVSAAASTGSAga------------gPVRPAAPARPg----gATV 680 Rho...
Q16BF7                   621 S-H-RFGAFINALCVDQDAIEDRISRvpssirISQAVGSSAMESTSsggaaspprpggasrPSRPGRPNRPg-------- 690 Ros...
WP_012177574             620 N-H-RFGAFLGALCVDQDMVQERIARvpssirISSAVSAAAAERPAavaaga---parpgrPARPGRPARP--------- 685 Din...
jgi:Ddes_1314            619 K-Q-LFGDFLRRLQVRDYDLYELCLN-------ARQMPEQGQPQASvqvvgt----rvsadDIL-------------GDI 672 Des...
PRJNA391730:Sp245p_04155 633 TdYtLFGHLLERLQVREATAREIFLN-------AAALKLDRLAPAPaevp--------ppvPDD---------------- 681 Azo...
Q9CK17                   635 R-SlCMGELLRHLQLPEETIRSLYFSdlddilGEEEVEQTYSPAEE-------------------------------FDL 682 Pas...
CBL44090                 646 R-AlLFGDLLQRMQISDDTLRTLYLR------VEEEVGEDASAAQEgnaa--------sggALNLGGDLINfg--gdFDL 708 gam...
WP_012987698             638 R-AgRHGELLAGLVPQRKALQELYMQ-------EAELDLSIEGKDEnesiaa----fgigsD---------------FDL 690 Xen...
CDK97433                 634 R-PtSFAEVLRALQPSSEHLRSLYLKaede---------------------------avesPAGTIAPAFGggglisLDI 685 Mag...
ESQ08920                 701 VLNAASAGACNSRDAAPDNAGTATG-SDRF-VTALMRHWIAHLKALGEDPARLAYLGIERAPLDDLVSELIIGADRIGLE 778 unc...
WP_013066381             681 ARPGGGPAPATPEAAARGGEQVRTLtLEEFqAEQSILLWIEGIKAFRDDPARASGYGLRPQSIADLVAELIHAARRTGLS 760 Rho...
Q16BF7                   691 -kPAPAAAEAETDVTAKTASLIRTMsSEDFqANTAIDIWIEHLSQLREDADRLATFSLTPEAAADLVRELVHGFRRTDVA 769 Ros...
WP_012177574             686 --AAVAPTEPAAEEEPASAPNIRTMtPEQFqADTAIELWVEGLKRFREDARLLEALALTPEAAAHLVTELIHGLRRTGVR 763 Din...
jgi:Ddes_1314            673 FGDNTESTPAAAKPSEQEQEQARDMa-GVF-TSLVMEHWIGRLRDLSASAEARSQLGLPALELDQLCHEIILAAARCRLR 750 Des...
PRJNA391730:Sp245p_04155 682 --DPWGAPAAAPAEAPPAARRPPPDrPAVF-AEQVMNHWTEHLRALSQDAGLLARLGLPAAALDDLVQEVIVGAHRRGLG 758 Azo...
Q9CK17                   683 FSDPAPVTTATPQRIEKVEE-------SRF-AQAVFKAWVSHLRNLTADHRLMQYLGVSVDNVENVVNELVTGATRLKLQ 754 Pas...
CBL44090                 709 FGGGSAEGAHSAAPTKPVSATSEGSd-ARF-ARVAFREWIHHLRNLPGDQRLMQYFGYPRAQIEALIDELVTAANRMNLQ 786 gam...
WP_012987698             691 FSD------------TPDETVSAHShEQEF-AHRVIKLWINYLRTVPEQTSMTDFIGLSRSIVEMLVDELITAIQRMDVE 757 Xen...
CDK97433                 686 FAAPVADAAPAPAPAPSGRA-------ALF-AKAAISDWLKQLRQLPESQELQTFLGLTSDILQALVDEVITGAMRFRLE 757 Mag...
ESQ08920                 779 GALIELLAEAEaQAAAKRa-gLAERQVHVSHARIARFINYLGYDDLPMDERPRSLL---GKQlgVFQPPPAIAIg----- 849 unc...
WP_013066381             761 GRMAERLSELNfGLTVER---LAPTAAVLTAEMINDFVATLGMSALPETARPTVTPe-vGPPrpAFARRPGQDD------ 830 Rho...
Q16BF7                   770 SEMKTLLKAIDyGLTVDK---QAPPAAIVCAETINSFVHSLGAEKLSDKDRPVIELq-dGHNrmAFEARPASDT------ 839 Ros...
WP_012177574             764 DAMIADLGKIAyGNTVDR---QAAPASIVCAEAINRFVHTLGAERLPPEARPQVETd--tGPrpVFAPRPAPDR------ 832 Din...
jgi:Ddes_1314            751 ENLEEQLRRGTsYSNIARe-rLVWKQVSLAADAINAFVDWLGFDPRFKDQSQRTILf-gGKSvsLFDPPQPIMG------ 822 Des...
PRJNA391730:Sp245p_04155 759 DAIAEGVRAQV-QAAHTRwddVVDRAVGIAMMRLNDYVACLGFAELDEAARPGFPEapqPRAraIFTPPPVPAG------ 831 Azo...
Q9CK17                   755 EQLSKIALRNE-RSGSKRd-qLAERQVFTMNTAIADFIAWLGYSDIALEQRPASRVl-aGQM--IFEQRPVEQHn----- 824 Pas...
CBL44090                 787 SHLLNVILGTE-QAGTKRs-qLVDRQVLIVQAAISDFIAWLGFVQVPPGERPESLVn-rGVP--IFSPPATVEPn----- 856 gam...
WP_012987698             758 GELMAVLANTE-QAGVRRe-kMMERQVSRVMHIMNDFITWLGYQNILSEKRPASRIn-kGQP--IFARPDKKDPalwkgd 832 Xen...
CDK97433                 758 EKLVDALHKASnRAAATRs-kLADQQVLVVTTIINDYVDYLGFSQTEITGRPASMMp--GRP--IFRPPAAIPTg----- 827 Mag...
ESQ08920                 850 -rLPILPEAPSNYSAHYILDWLEAFRAMAIGNAGHAAGQDISAEQNARLGAIL 901 uncultured Thiohalocapsa sp. P...
WP_013066381             831 --VTGLPATPRATASDMWEDWAFALDAVMDANARDGLGGDIDIEQNLRLGAIL 881 Rhodobacter capsulatus
Q16BF7                   840 --AFDLPQEQRAAAEDFWTDWVYMLEALFVGNAKDGDAGEINIEQNMAIGRVV 890 Roseobacter denitrificans OCh 114
WP_012177574             833 --LDGLPEIPRASAEETWTDWVFMLEALFVGNAGDTDAGEINQEQNRRMGRIL 883 Dinoroseobacter shibae
jgi:Ddes_1314            823 --EPRIGEQEAPYDRLWYTDWLRALAYSITANVDFDGQQTLDPEQNNRLRDIL 873 Desulfovibrio desulfuricans AT...
PRJNA391730:Sp245p_04155 832 --LPPLDGRRLPMERDRFIDWGVAFRQLGLDNVSFAGGREIGEAHNRALGEIL 882 Azospirillum brasilense Sp245
Q9CK17                   825 -gLPKLNDHTSNYDDNYRLDWLVAFGHFAVNNAGHSAGREMNAAQNAQLGNVL 876 Pasteurella multocida
CBL44090                 857 -rLPQLPSQPINHSAFYLYDWLVAFSRVAISNAGHSAGREITPEQNDALGKII 908 gamma proteobacterium HdN1
WP_012987698             833 erLYRLTNEQLNYSALFIYDWLFGFGEIIKENAGHSAGREITAVQNERLGTII 885 Xenorhabdus bovienii
CDK97433                 828 -tLPVLDANPVPYSGLYITDWFEAFRATAIANAGHAAGSEITPEQNERLGKIL 879 Magnetospirillum gryphiswalden...
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap