Conserved Protein Domain Family
NADHdeh_related

?
pfam10125: NADHdeh_related 
NADH dehydrogenase I, subunit N related protein
This family comprises a set of NADH dehydrogenase I, subunit N related proteins found in archaea. Their exact function, has not, as yet, been determined.
Statistics
?
PSSM-Id: 401936
View PSSM: pfam10125
Aligned: 6 rows
Threshold Bit Score: 261.586
Threshold Setting Gi: 124362933
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
O26491         1 MMdiasLGGELLGQIPFGDIVLYLTPFNLFMFAAVLIFTFLIAISRTETQVETEFGTLGNRRVEVDTAEFRIRRFLAIVC 80  Methanothermoba...
Q8TY36         1 MY----PSGKVLFIIPLGDIVPYLSTINMIILAVLLAVLALPILSNTDVYVEIDHRRPRIKAKIVSPREDKIKAALALVS 76  Methanopyrus ka...
Q2FMA7         1 MFnl-pIEGEELFVLEFGDIVNYFSLYTTTLFLFATAFIIIAIIARPERQTDIVFGTDAIYTKEINPDNLRFQRFMAIAC 79  Methanospirillu...
ABN06741       1 MM------ESILVTIPFGDMIHYLSGYTGVLFGFAAIFVLLAVISLPEKPVEIVFGTDGYSLKETPVDLARFQRFMAIAC 74  Methanocorpuscu...
WP_011973083   1 MLe--sIAGSLYGYIPFGDIVFYMTDFSMIAFVVALFFTIIVALTKPEKQIEAQIGELGDKFNTVSLKEMKARRLMAVIC 78  Methanococcus a...
Q57942         1 MIe--sITGYLFGIVPFGDIVFGFSEFSIIGFITAVIFTIIVYLTKPEKQLEAQKFKIEDKLEVVTLNELKIRRMMAIVC 78  Methanocaldococ...
O26491        81 GLATAGAMVTGDLFNFTLFVALIGIVNIGIV-SAVRQVEVLDAAFQYGLIAMMASLPLFGGAALVLGSSGTLSLLELSGM 159 Methanothermoba...
Q8TY36        77 TLAATGVVTTGDVFNFTLFLSLLGISNMGLIgTTVEDEFALECAFNYGLMCLIASLPLFGGAALILASTGTLSVHELMKM 156 Methanopyrus ka...
Q2FMA7        80 GLATLGAVSSGDLFNFSLFTALIGITNIGIV-AGVNNRYVLNAAYNYGIVAMVATTFLFGGAATALGTCGTLSIWELAGL 158 Methanospirillu...
ABN06741      75 GIATIGAIVTGDIFNFTLFAAFIGVLNIGIV-AAVKNKHVLSAAFSYGLVVMMGTVPLFAGAAIIAATTGTLSIWELAAT 153 Methanocorpuscu...
WP_011973083  79 GITTAFAMLTGDVFNFALFLAVIGMANIGIV-SAVKKEWVLTAAFNYGIIAMISTLPLFGAASIILAKTGTLSIFELSRH 157 Methanococcus a...
Q57942        79 GIATAGAMLTYDLFDYALFLTLVGIANIGIV-SAVKREWVLNASYQYGLIAMIATLPLFGSAGMILAKTGTLSIFELPKI 157 Methanocaldococ...
O26491       160 ---AGNpMIVFAALLLLMGVVGETGVAPFYATKAEMFRTPGSPFILIIHLSSLLVIVRAIEVLLIV 222 Methanothermobacter thermauto...
Q8TY36       157 pkgAGGwTLTYGKALLTAGVIGEAGVGPFYAVKVDSFRRIWGRYAFVIHLTTLLTFSRYLELLAAL 222 Methanopyrus kandleri
Q2FMA7       159 ---GM--VPLAAKMFLVLGVMGE-GMAPFYIAKAEITRAPGAPYVLMIHVSSLLIFLRVIEIILTV 218 Methanospirillum hungatei JF-1
ABN06741     154 ---GG--VPVIAKLLLLIGVLGE-GMAPFYIGKAEITRASGAPYILMIHVSSLLLFLRVVEILLTV 213 Methanocorpusculum labreanum Z
WP_011973083 158 ---PYD--IFYQKILYAVGMVGETGIAPFYAAKAEMFRAPGAPYILMIHLSSLLVIVRTAEILLNI 218 Methanococcus aeolicus
Q57942       158 ---QTS--LLFEKIIFAAGMAGETGIAPFYAAKAEMFRAPGSPYILMIHLSSLLLIVRTVEILLTI 218 Methanocaldococcus jannaschii...
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap