Conserved Protein Domain Family
Mu-like_gpT

?
pfam10124: Mu-like_gpT 
Mu-like prophage major head subunit gpT
Members of this family of proteins comprise various caudoviral prophage proteins, including the Mu-like prophage major head subunit gpT.
Statistics
?
PSSM-Id: 401935
View PSSM: pfam10124
Aligned: 31 rows
Threshold Bit Score: 415.86
Threshold Setting Gi: 81461162
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
jgi:DvMF_0735   9 LNSLRTGFSAAFQRGKTKAAPMWDKVATLIPSTAAQNTYGWLGQFPKLREWVGDRVFKDMKEHGYAISNKLYEGTVGVSR 88  Desulfovibrio ...
WP_002442936    9 LHALSTSLSAAFTKGLAGVTPQYLRIATVVPSSAASNTYGWLSELPGIKEWVGERQLVRLSEQGYTITNKTWESSIRVKR 88  Shimwellia bla...
Q8EDQ8          8 LEALQATMSAAYTRGLSAAKPQWNMIATEVPSAGAANFYGWLKDLPGIVEWTGARQLANLGKHGYSIENKTFESSISISR 87  Shewanella one...
Q8EJ00          9 LQALRTMVRSEFQNALTKTEPLYLKIASVVPSNTKSNTYGWLGSMPTMREWIGARVINSIKEHGYSITNRTFETTIGICR 88  Shewanella one...
CBJ91431        9 IKSLFTGWNGDFQNGLEDAPSQYEKISTVVPSTTKSNTYGWLGKFPGMREWIGDRVISDMQAHGYQIVNRPFESTVGVDR 88  Xenorhabdus ne...
WP_012728971    9 VQALFTGFKKNFEDGKSEAPSQYTKIATVIQSTTKSNTYGWLGKFPSLRKWIGDRVINSMAAHGYNIVNEDYESTVGVDR 88  Tolumonas auensis
Q9T1W1          8 IKALMTSWRKDFQGGLEDAPSQYNKIAMVVNSSTRSNTYGWLGKFPTLKEWVGKRTIQQMEAHGYSIANKTFEGTVGISR 87  Escherichia vi...
P44227          9 VKALFVGFGKNFKDGLAKAPSQYTEIATVVKSTTASNTYAWLGQMPGLTEWIGDRTLTAIQSHGYSIVNKKWANGVEIQR 88  Haemophilus in...
WP_012341498   11 LKKLDTQFRAEFSKGIAHIQPQYPKIAMTVPSNTATNTYGFMRAFPKMTEWAGKRTIKNMSAVGMTLDNKKYESTVGVPR 90  Histophilus somni
AJA73188        8 LKALDTAFRKEFSAGLKVLEPQWGTVAMKVSSSTATNTYAWLGQFPKMQEWVGDRQIKNMQAQGMTIENKLFESTVAVPR 87  Mannheimia pha...
jgi:DvMF_0735  89 TSVEDDALGIYTPLFEEMGYGAATHPDELVWPLLANghARTCFDGQNFFDTDHPVypnVDGTGEAVLVSNNLvPGAnpGA 168 Desulfovibrio ...
WP_002442936   89 ESIEDDQIGQYSVIAQAYGKQVSEFPDTLSFPMLVAgfSTLCFDGQNFFDTDHPM--------AGGTYSNIV-GDVttDA 159 Shimwellia bla...
Q8EDQ8         88 DNVDDDQIGQYSVIAQNYGDQVAYFPDTLAYPLLKAgfTTLCYDGQNFFDTDHPLat-----tPATTFSNVI-GDPatDT 161 Shewanella one...
Q8EJ00         89 DDVEDEVIGTYKPMVQALAQEGEEFPDDLVFELLADgfSTLCYDGQNFFDTDHPVnekHDGTGDNVSVANMAlDAAytGE 168 Shewanella one...
CBJ91431       89 DDIEDDNVGIYSPLFTEMGRAAGVQPDEMCFSALRDgfQTLCYDKQNFFDTDHPVyptVDGKSEAKHVSNILaEEGykGQ 168 Xenorhabdus ne...
WP_012728971   89 TDIEDDEIGIYSPIFAEMGRAAAIHPDESVFALLPAgfTTACYDGQYFFDTDHPVypnADGTGTAVSTANVVvDGLytGE 168 Tolumonas auensis
Q9T1W1         88 DDFEDDNLGIYAPIFQEMGRSAAVQPDELIFKLLKDgfTQPCYDGQNFFDKEHPVypnVDGTGSAVNTSNIVeQDSfsGL 167 Escherichia vi...
P44227         89 TDIEDDNVGVYSPLIEELGRAAGEKADELVFGALTAgfKTACYDGQYFFDTDHPVganVDGT-NQKSVSNITdDSTgvTE 167 Haemophilus in...
WP_012341498   91 EAIEDDQVGLFRNMMAQAGQSAAELPDELIFKLLLAgeSTLCYDGQNFFDTDHPYyqdVDGTNAGTAQSNITtGSDsgAK 170 Histophilus somni
AJA73188       88 TAIEDDQVGLFTPMVKQAAQSAAELPDDLVFSLLKKgkTTLCYDGQNFFDTDHPVyqnVDGTGTSKTQSNITtGSAsgKP 167 Mannheimia pha...
jgi:DvMF_0735 169 --AWFLLDVSRPLKPLIFQERTKPE-LQMISNPDNDHVFMKDEIPYGVRYRCNAGYGFWQMAVRSQH-PLTADNFEAALV 244 Desulfovibrio ...
WP_002442936  160 gePWFLIDESQVLKPILYQDRRAFD-FKSLDDLNSEHTFLQNEFLFGVDGRCNVGFGFWQTAVASRA-PLNAANYEAAVK 237 Shimwellia bla...
Q8EDQ8        162 gePWFLIDDTKVLKPIVFQNRRPFV-FKNM-NPNEEYTWFNNKYAAGVDGRCNVGFSFPQLAIGSKA-ALTEANYAAAKK 238 Shewanella one...
Q8EJ00        169 --PWFLLDTTRPLKPVIFQERRKLD-LNTLFNPTDPAVWTNNEFQFGTDMRCEAGFGFWQMAFANKR-ALNADNLWDTIE 244 Shewanella one...
CBJ91431      169 --PWFVLDCSRAIKPVIFQQRKAPE-MVAMDKVDDEQNFMRKLIRYGVDTRCEAGYSFWQLAYAAKA-QLTADNVWSVIS 244 Xenorhabdus ne...
WP_012728971  169 --PWYVLDCKKALKPFIFQERKKPE-LVAMTKTDDEAVFTSKQFRYGVDCRDAAGYGFWQMAYANKR-ELNADNLWDCIQ 244 Tolumonas auensis
Q9T1W1        168 --PFYLLDCSRAVKPLIFQERRKPE-LVARTRIDDDHVFMDNEFLFGASTRRAAGYGFWQMAVAVKG-DLTLDNLWKGWQ 243 Escherichia vi...
P44227        168 anAWYLLDCSRSLKPIIYQERKAPT-PAQITDANDEKVFMKDVFTYGVDSRSNVGYGFWQMAHAVKG-KLTAENLWKAIE 245 Haemophilus in...
WP_012341498  171 --SWYVLDTNNVIKPFIFQERTKPEfEGKFDPSKSDTVFMEDVYLWGVRYRCNAGFGFWQLAHKAKQlNLTADNVMAVIT 248 Histophilus somni
AJA73188      168 --AFYVLDDSQAIKPLIWQERTTPEiETKFDPSESDHVFMKDQYLWGVRARGNAGFGFWQLIHRVEDsELNSETLEKVLT 245 Mannheimia pha...
jgi:DvMF_0735 245 VLQTMKADGGRPLGLgsggkASTLLVVPPTLNGAARGVVGVSELP-GGG----TNKWFD-AATVVPVAWL 308 Desulfovibrio vulgaris s...
WP_002442936  238 VLQGMKRDNGLPLGI-----RPTTLVVGPNNRAPAKRVIDAMLVD-GGN----SNIYYK-DVDIVDSPFI 296 Shimwellia blattae
Q8EDQ8        239 LLLKMKKVDGTPIGT-----RATKLVVGPDNEAAAKKLISRMLIE-GGD----TNIYYN-DVEIVVSP-L 296 Shewanella oneidensis
Q8EJ00        245 KMKAFKRDGGKKLKI-----RPSLLVVPSSLEQAATKLLTRELIDeNGTt--vENELKG-KVELLVVPQL 306 Shewanella oneidensis
CBJ91431      245 AMRGFKADGGRPLAI-----RPTHLVVPPTMEKLATQLLERELTL-DSQggtvSNEMKG-RLELIVGDYL 307 Xenorhabdus nematophila ...
WP_012728971  245 KMRQFESDGGRKLGI-----APTMLVVPPSLEKLATRLLERELDS-NS-----SNELKG-RLELVVGDYL 302 Tolumonas auensis
Q9T1W1        244 LMRSFEGDGGKKLGL-----KPTHIVVPVGLEKAAEQLLNRELFA-DGNtt-vSNEMKG-KLQLVVADYL 305 Escherichia virus Mu
P44227        246 AMRAVRGDGDKRLAI-----RPTHIVVPPSLAQAATKLLERELRAeDGVa--vDNEFKRmNLKLIVGDYL 308 Haemophilus influenzae R...
WP_012341498  249 KMTTLKADGGVFINV-----RPTTLLVPPSLEKAALDICNADVI--GGT----TNTLKG-RLQVMVSPYI 306 Histophilus somni
AJA73188      246 AMRTLKGDGDKQLNI-----RPTTLLVPPSLEFAARKLLEAELI--DGT----TNTLKG-VLKVVVNPFI 303 Mannheimia phage vB_MhM_...
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap