Conserved Protein Domain Family
DUF2336

?
pfam10098: DUF2336 
Uncharacterized protein conserved in bacteria (DUF2336)
Members of this family of hypothetical bacterial proteins have no known function.
Statistics
?
PSSM-Id: 401913
View PSSM: pfam10098
Aligned: 96 rows
Threshold Bit Score: 81.541
Threshold Setting Gi: 122418175
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
CCC97013       156 VCAPVLQFSPILTDEDLADIIMRGPVAgALSAIAGRKQISASVADAIARSDDEAAMTALLANPSAQIREETLDRILDQAP 235 Azospirillum ...
jgi:Caul_1356   92 VARALLENSPSLSDADLISCLYNATQD-HRRLIALRRGVSEVVADALVDMDETAVTETLLKNELARFSHQGLENIVAATR 170 Caulobacter s...
WP_013268617    90 IAGLLIEGCASLSDADLVACARDTGID-HRFLMASRRGLSEVVTETLIAFDEAPVIEAVLRNTTSRLSQNGVEEIVSLSR 168 Brevundimonas...
jgi:Astex_0619 110 VARFLIEDCDSLAETDLLYCIRRGTPT-HCRLLATRKYIGPVVAEALTDTGDIATVEQLLKNRTSTLSQGAIEAAVSLSQ 188 Asticcacaulis...
Q0C487          80 VARPLLEESDAFDDCDLAEIIRQTTPE-HRLTIARRRNLSAAVTAVLADVSEPHVVREILANRTAVFAETTMDKLIAASR 158 Hyphomonas ne...
Q0ARB2          88 VAEPILADCLALSDFDMMEIARVGKLQ-HRLALANRENLSATVSASLAAAGETPVIERLLRNKTCVLAMPTVDHLVGMAA 166 Maricaulis ma...
jgi:Hbal_1218   88 VSSQLLEESAAFDQSDLVSIVVSGAAH-HRRAIAARKDVGSCLSDAISQSRDTEAIARLLMNDKAIVSELSIDRLVSLSR 166 Hirschia balt...
jgi:Oant_2680  145 FADPVIDRTLTLQEN---------------------------LANIEAEPLERPDVPDLSAARAPLMKEDSSERLARALQ 197 Ochrobactrum ...
WP_013653681    92 VAYPVLLHAAVLPEDTLLAVAERGPDS-LRRALSRRPELPESVLERLAARGDEAAVRLLIAHGRPLLPVPALAALCARPE 170 Polymorphum g...
Q3STJ0          41 THTVEEERHFVELTSRLIDHVDDATRAvVRARLSIYPRTPAAIMNKL-------RLGAFAADPRPDSPPPQATPLKAPPA 113 Nitrobacter w...
CCC97013       236 QHEPWHAPLVRRPRLPARAVARLASFVADNLLKVLRERTDLDPAAARALAEGVRARVNRGAGGNggggpgaarglvdfge 315 Azospirillum ...
jgi:Caul_1356  171 DNPQLIPLLLKRSELRPSHAYVMFWWSDADARRTILQRFAVSREILQDAVGDVFPLASAEGWQDpl-------------- 236 Caulobacter s...
WP_013268617   169 NAPELCGHLLRRSELRPSGAYVMFWWCGAEDRKTILQRFAVSREVMQEVVEDVFAMAAEEGWQDpv-------------- 234 Brevundimonas...
jgi:Astex_0619 189 DAPRLVPHLIRRLELRPSSAYVMFWWADADVRRVILSRFAVNREVMQDSAGDVFAMAAKEGWSDpl-------------- 254 Asticcacaulis...
Q0C487         159 DEPSYCLLLVDRIEIKPSHAMAMFWWADAVTRRKILTRHAAERQEMITLCSDVFELAAAEGWQDpv-------------- 224 Hyphomonas ne...
Q0ARB2         167 EEGNLAHLLIKREELRPTQAFRLFWTCEHMARAQILERFAVDRTILIDASEDIFPMAAAEDWSDpm-------------- 232 Maricaulis ma...
jgi:Hbal_1218  167 NIERLGPLLLRRPELRPAHALVLFWWSDQATRRLILQRFSAERSVLIDMCSDIFAHAAKDNWSDpv-------------- 232 Hirschia balt...
jgi:Oant_2680  198 QPFFEAGATT---------------------------------------------------------------------- 207 Ochrobactrum ...
WP_013653681   171 IMAVIGPELAGRALLPSDLLIAHYPTLDAANRQRAIAAAELRALADR--------------------------------- 217 Polymorphum g...
Q3STJ0         114 ETRTRPVAILSMEPRDAAEISEMFFGANSKDRALILHNLATAPLRPSPHIHPSRAAR----------------------- 170 Nitrobacter w...
CCC97013       316 eelghlpgdkdkaaeRPSDkaaRLNKEGKL--------TEKLLEGALAEGDRAFVLAGLGELAQLPMPIIDRIIGTHAPR 387 Azospirillum ...
jgi:Caul_1356  237 -------------srKALQfieRRQRNRAAiakspydsLEAAIA-AAQNGMTRETAEEISYLSGLKPMTGAKIFTDPGGE 302 Caulobacter s...
WP_013268617   235 -------------srKALQfieRRQRNRAAiekspytsLEHAIAEAAKSGLGREVAAEIAYLAGIKPLTGAKILGDVGGE 301 Brevundimonas...
jgi:Astex_0619 255 -------------arKALQfieRRQRNREAlkkspfasLEAAIAEAARSGMTRHTAEEISYLSGIKPSTGAKILRDGGGE 321 Asticcacaulis...
Q0C487         225 -------------arKALQlieRRQRNRAAierspydsLESAVQAAAASGMDAKVAQEIGYLSGIKPVTAAKILSDPGGE 291 Hyphomonas ne...
Q0ARB2         233 -------------vtRILRyidRRQRNREAaelspygsLEGTLEAMAMDGALPEIVTEISTLANVDRRLVLQMVDDMAGE 299 Maricaulis ma...
jgi:Hbal_1218  233 -------------vrKGLQvieRRQRNRAAiekspfssLEDAIAHMLKSGYQAKTIDEISYLCGIKPMTGQKIISDEGGE 299 Hirschia balt...
jgi:Oant_2680  208 --------------------------------------GSQHLIDTALLIDSQFFRNALADTLDLSFERSDAIIGQWPDS 249 Ochrobactrum ...
WP_013653681   218 ----------------------ARQGGTRApqpafkpaLLQRIVAAALTGGRASFARQIAYALGLSAGLAARVTVDASGE 275 Polymorphum g...
Q3STJ0         171 --------------------------------------AIEVLHMAAFASDVGNFATEISATLMLPAAIAERVVKDPGGE 212 Nitrobacter w...
CCC97013       388 AVTSLVWRCGLSMRFARQVQLRIAQIPPk------tALMAKEGVLYPMSDDEMRWQLA 439 Azospirillum brasilense Sp245
jgi:Caul_1356  303 PLAILCKATGLPRGAVRALWRGLRRPETdasgaptpGLERVLTAFDTIAVDRAQTMLR 360 Caulobacter sp. K31
WP_013268617   302 PLAILCKATGLSRVDLQNLWRSVRRPETradgtvhpDWERVQITYEMLAVDRAQTVLR 359 Brevundimonas subvibrioides
jgi:Astex_0619 322 ALAVLCKATGLKKADLRNLWRALRRPGqkdg-evhpDLERVLVVYDTLAVDRAQTVLR 378 Asticcacaulis excentricus CB 48
Q0C487         292 ALAVLCKATGLKREYLGMLWTALNRPLDlepgvahpQFLIVSETFEVLSVLKAQTTLR 349 Hyphomonas neptunium ATCC 15444
Q0ARB2         300 AIAVLCKATGLKWPSFENFWRGLGRSLTs------ePVPQARKVYDSLSVEKAQTVLR 351 Maricaulis maris MCS10
jgi:Hbal_1218  300 GIAVLAKAVGLKRQYFKAFWAALGRPISrkda-pveHFEYVLEIYEMMAVAKAQTVLR 356 Hirschia baltica ATCC 49814
jgi:Oant_2680  250 HLPIALKALGLSPAECYLVMTAILgpid----tnrdSLREFVHIYRSIDREKAMALVR 303 Ochrobactrum anthropi ATCC 49188
WP_013653681   276 PLVVCLKALGLAPASVATVVVRIvgrt-----lsieQLRALLAFHDALSPAAALVLVG 328 Polymorphum gilvum
Q3STJ0         213 PLACAAKAIGIPSQTFQQILLFLDpaig----tsvtEVYRLARLYDVLSERAARIMLA 266 Nitrobacter winogradskyi Nb-255
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap