Conserved Protein Domain Family
DUF2310

?
pfam10071: DUF2310 
Zn-ribbon-containing, possibly nucleic-acid-binding protein (DUF2310)
Members of this family of proteobacterial zinc ribbon proteins are thought to bind to nucleic acids, however their exact function has not as yet been defined.
Statistics
?
PSSM-Id: 401891
View PSSM: pfam10071
Aligned: 23 rows
Threshold Bit Score: 310.744
Threshold Setting Gi: 123530217
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
jgi:HSM_1327     1 MYLVEVFFTYRQPQKLPISNIsyLINQIIEQWRYNGQIIGREIPLFVAVQnn-eeGFALRVTCPEQQSLLP-----TFNN 74  Histophilus s...
Q2S7M6           4 H---KVTFGSLVNDDKDEALE--LAFSFLSTLAHNGQVNVDDYVCAVQQG----------IVCAYVNALGPsatelSFFN 68  Hahella cheju...
jgi:Dtox_1984    1 MYTAELIFKLEQGKDTKNAEE--AIDVLLGALRMNGQILGREFPVGRKDE-----NYRAYLLLPTTDSLDK-----KCAN 68  Desulfofarcim...
jgi:Solca_0447   1 MYIQEISLEINSGVDIVLIED--QFDILMSHYRGSGQTQGK-----IESQytsgnKIISLPYTHEDESLHK-----NYNN 68  Solitalea can...
WP_014218096     1 MYIQEISIEIKTTANKNVLVD--EFQLLMSFYRGSGQTQGK-----IESQyiaenKIVSLPYTLEKNSLAR-----KYNN 68  Niastella kor...
P44154           1 MYLIETYFRLTALENNIESQSr-LLNAVIDQWRYNGQIIGREIPLYLAEEdg-aqGFAMRVICPEQDSLFP-----QNNN 73  Haemophilus i...
WP_012072943     1 MYLIEVFFRNQPADNLLAQMP--LINKVIDQWRYNGQILGREIPVFPAQQdg-qpGLATRVICPEQSSLLP-----ENNN 72  Actinobacillu...
Q65TN3           1 MYLVEVFFKNINEDNLPQQIP--LINQLIDQWRYNGQIIGREIPVFVANQen-erGLATRVICPEQQSLLP-----EYNN 72  [Mannheimia] ...
Q7VLG0           1 MYQVIANFSFQNFEHDPVI----LINQIINQWRYNGQIIGREFSVTYHTQps--aHFQVRLATPEQISLMP-----EWNN 69  [Haemophilus]...
WP_015432688     1 MYQAIAHFSYQNFEQDPVN----LINQILEQWRFNGQILGREFGVTHHKLge-qfEFQVRLSLPEQDSLLD-----KYNN 70  Bibersteinia ...
jgi:HSM_1327    75 IQVDKALEQAKSAGIFFDSFQIIADDLNSDITY-PKEVATWQVLYTTYLQSCSPLHSGDNLLPIPLYKQFKNIPHLSMDI 153 Histophilus s...
Q2S7M6          69 RYGLSSLEGLKGYFGGEPVWEMLEDNAPKKEAS-WKGAPFLY-LHTLDNGGESPLYRGDNGENITLYTVP-CDADERERA 145 Hahella cheju...
jgi:Dtox_1984   69 NYVRDAIHKLDEVGLNYSSV-LTGKEPYAASAC-RCGASKSFILYTHYISLESPLRCGCCFGIIPLYRLHPTSNGEYVDI 146 Desulfofarcim...
jgi:Solca_0447  69 RYVNRQTLKIEELCASKLQFSTVGKSYHDYESAcKCAKPAFYILITNYLSISSPVKCGNCYMPVPLYKLPEYYDYGYMPI 148 Solitalea can...
WP_014218096    69 FYVNNQIQKLEELCKSTLQFRTVGKYSNSYKTPcTCKKSDFFILTTNYVSIDSPLTCGTCNKSVPLYRLPVYYDYGYMPI 148 Niastella kor...
P44154          74 AEVNRALQEAEKCGVIFDGFQLVGDDFNSDQTA-ENASPAWQVLYTTHLQSCSPIHSGENFAPIPLYKQLKNQPHLTQDL 152 Haemophilus i...
WP_012072943    73 VEVEKALAQAEKCGLFLDSFQIIGEDLNSDITF-AQNKPQWQVLYTTYLQVCSPLHSGDRLAPIPLYKQLKTIPHLSIDI 151 Actinobacillu...
Q65TN3          73 AEVNRCLANIENCGLILHSFQIVGEDLNSDITY-EDKKPDWQILYTTYLQVCSPLHSGDRLAPIPLYKQLKDVPHLSMDV 151 [Mannheimia] ...
Q7VLG0          70 DQVTEALSQAAEKGVEFESFEIIGRDYQAEQTS-ENSNARFYILYTTHLDSCSPLYNGDDFCPVPLYRLLQKDQSLAQAL 148 [Haemophilus]...
WP_015432688    71 DWVRQAIEYAEQAGVALIFFEIVGRDYNENDTA-NCEPASFQLLYTSYVDSASPLYHGDVLQTIPLYRL-GDQPELTEQI 148 Bibersteinia ...
jgi:HSM_1327   154 IKWQENWQACDQLQMNGSILEQQALYEISDFNSHLTKHGYYLTQEIEKHTGIPTFYYLYRIGGDNLQSEQQRLCPNCQQK 233 Histophilus s...
Q2S7M6         146 YFWQRDYRQCDSIWMRSAVLESETYKELADANSALTLAGKEVCRIIEAATGVPAYYFLFRYWGRRKNEE-KRWCPGCGGD 224 Hahella cheju...
jgi:Dtox_1984  147 LTWQSDYQACDTLQMNSATGERFALHQISRFDSSLSQRGIEICNNITSLTGIPTYYYLYRAIRRGKKSEQKRKCPSCTDD 226 Desulfofarcim...
jgi:Solca_0447 149 LSWESNYISCDTLQMNSEVGERWGLNQMQNFDSSLSKQGREICKKIEELTNTPTYYYLHNY-RKIKGDQLKTPCPSCNKK 227 Solitalea can...
WP_014218096   149 LSWETNYISCDSLQMNCEVGERWALNQMQDLKSPLSKQGFKICKKIGELTSIPTYYFLYNY-TKFKGDNLSRSCPGCNKK 227 Niastella kor...
P44154         153 IKWQENWQACDQLQMNGAVLEQQSLAEISDHQSTLSKHGRYLAQEIEKETGIPTYYYLYRVGGQSLKSEKSRCCPSCGAN 232 Haemophilus i...
WP_012072943   152 IKWQENWQACDQLQMNGAVLEKQTLAEISDTAGNLFKHGYYLAQEIERHTGIPTFYYLYRVGGESAKSESARLCPLCGGE 231 Actinobacillu...
Q65TN3         152 IKWQENWQACDQLQMNAVALESQALREISDINSRIFKHGYSLTKEIEEHTGVPTYYYLYRVGGKNLASESARHCPICHGD 231 [Mannheimia] ...
Q7VLG0         149 IKWQENWQACDQLQMNGTILEQPALNEISEIDSNLAQLGIKLCREVERVTQVPTYYYLYRL-GTDEAVEYQRKCSSCGAE 227 [Haemophilus]...
WP_015432688   149 LKWQENWQACDQLQMNGGVLEQEALAQISELESPLSQQGRALCAAIEQVSQIPTYYYLYRL-GSDINLENERKCPSCHGE 227 Bibersteinia ...
jgi:HSM_1327   234 WHLDKPLFN-----LFHFKCDHCRLVSNLSWHW 261 Histophilus somni 2336
Q2S7M6         225 WRTGHSTERggdlwLFPYQCEPCRLVAshalad 257 Hahella chejuensis KCTC 2396
jgi:Dtox_1984  227 WFLKEPLHQ-----LFDFRCDRCRLLSNFa--- 251 Desulfofarcimen acetoxidans DSM 771
jgi:Solca_0447 228 WSLKKQLHS-----VFDFKCDYCRLVSSVSpns 255 Solitalea canadensis DSM 3403
WP_014218096   228 WGLKKRLHD-----RYDFKCDRCKIVSEISnkt 255 Niastella koreensis
P44154         233 WALKDAIFD-----TFHFKCDTCRLVSNLSWNF 260 Haemophilus influenzae Rd KW20
WP_012072943   232 WRLPTPLFD-----LFTFKCDDCRLVSNFSWNW 259 Actinobacillus succinogenes
Q65TN3         232 WKLAQPLFD-----QFHFKCDHCRLVSNISWNF 259 [Mannheimia] succiniciproducens MBEL55E
Q7VLG0         228 WRLTEPLHQ-----IFHFKCDKCRLISNLSWQL 255 [Haemophilus] ducreyi
WP_015432688   228 WKLTEPLHE-----IFHFKCDKCRLLSNLSWEL 255 Bibersteinia trehalosi
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap