2LV5


Conserved Protein Domain Family
DUF2288

?
pfam10052: DUF2288 
Click on image for an interactive view with Cn3D
Protein of unknown function (DUF2288)
Members of this family of hypothetical bacterial proteins have no known function.
Statistics
?
PSSM-Id: 401877
View PSSM: pfam10052
Aligned: 77 rows
Threshold Bit Score: 98.7291
Threshold Setting Gi: 189422273
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
2LV5_A             10 TLYAKLLGETAVISWAELQPFFARGALLQVDAALDLVEVAEALAGDDREKVAAWLSGGGLSKVGEDAAKDFLERDPTLWA 89  Pseudomona...
Q602K7              7 SIYAKLNLDSGKLTWQEMQPHFARGAIVRVAPGLDLIEVATVMAADETRTLSRWLRDGQVGRATATEARDWHERDPLFWA 86  Methylococ...
jgi:TK90_0240       9 epevPLEEEAGPLRWDELMPHFARGVVIRVAPELDLIEVARAFRDDATHQVSEWLANNQVARASDDDARRWAANDPVFTA 88  Thioalkali...
Q3SGY6              7 ILRAKLNLETAQLAWPELERHFARGVVVKIAPGTDLVDAALQFAENNAAAIQAWLEDGRVARAELADAEDWHARQPRFWA 86  Thiobacill...
jgi:Hneap_1722     26 drwalffGQTAPIGWAQIEPFFARGQVIHVGSSLDLVEVAVAVAEDDKSRVADWMASGDFVLLPTDIARHWSSDAADLWG 105 Halothioba...
zhongguo:Q91_0089   6 dqwHTLHAETASIEWKDLERFFARGNLLRVSSELNLVDAAVEMANDNKPVIEQWIAENRLSAVSNEEALLWSKGDSNLWS 85  Cycloclast...
WP_011872724        9 lLHAKLNMETSQIAWAELLRYFAGGLVVVVADDMDLVEVAARFTIDDKVLVEQWLNAGKIAKATDAQASQWLEADAMLWT 88  Herminiimo...
WP_013820468        8 leKTKLNQETSLISWLELQRFFAAGLAISVEKELDLVEVAYQFSIDNKQIVNDWLQAKRIAPVSDQLARDWFENKADVWA 87  Methylomon...
WP_038649451       13 pLEQKLNLETARINWHELQTHFARGVCIYVAPELDLVNIAHMIATDNSAAIALLIQEGKIGKVSDIMAQQYYDCNQPMWA 92  Snodgrasse...
jgi:Tgr7_0160       7 ELRARLNAETGPISWPELERHFARGVVVHVAPELDLVEVAARMVEDDRDSISAWMDAGQLGPATDAQARDWQTRRPDFWA 86  Thioalkali...
2LV5_A             90 VVVAPWVVI 98  Pseudomonas aeruginosa PAO1
Q602K7             87 VVVAPWVLV 95  Methylococcus capsulatus
jgi:TK90_0240      89 IVAAPWVLA 97  Thioalkalivibrio sp. K90mix
Q3SGY6             87 VVVAPWVLV 95  Thiobacillus denitrificans ATCC 25259
jgi:Hneap_1722    106 VVVTPWVLI 114 Halothiobacillus neapolitanus c2
zhongguo:Q91_0089  86 VIVLPWILV 94  Cycloclasticus sp. P1
WP_011872724       89 VVARPWVLV 97  Herminiimonas arsenicoxydans
WP_013820468       88 VVVKPWILV 96  Methylomonas methanica
WP_038649451       93 VVVMPYVLV 101 Snodgrassella alvi
jgi:Tgr7_0160      87 VVAAPWVVI 95  Thioalkalivibrio sulfidiphilus HL-EbGr7
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap