Conserved Protein Domain Family
DUF2274

?
pfam10038: DUF2274 
Protein of unknown function (DUF2274)
Members of this family of hypothetical bacterial proteins have no known function.
Statistics
?
PSSM-Id: 401866
View PSSM: pfam10038
Aligned: 59 rows
Threshold Bit Score: 70.2944
Threshold Setting Gi: 501232024
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q210W6                           1 MTKLKLGSLLDDRPVKLSIELPASVHRDLVAYGELLAQITGTTGpiEPVKLIAPMLERFMATDRVFA-KARR 71  Rhodo...
Q11BJ7                           1 MSDLKLGPLPKIRYVRRTIMLPEPLSEELEQYAAEHSRLYEPV---DAIALIPHMLEDFLRSDRGWRnRKAR 69  Chela...
CAP44978                         2 aTKLRLGPLPKQESVKLTVSLPTTLKADLDRYAAMHSQAYGEQV--DAATLVPHMLAWFLKNDRGFR-Hlnn 70  Borde...
WP_013791221                     3 tvKLRLGPLPKTENLKLTFTCPASLKADLEKYASLHSHAYGEEV--DALTLIPHMLEAFMSRDRAFK-RAma 71  Pseud...
WP_013041087                     1 MADLKLPRIPDRKPVKFTISILPHLHQAIIEYAALYSQTYGREE--PITELIPAMLEAFLESDRLFG-AKRR 69  Sphin...
WP_014076916                     1 MADLKLGKLPDRTPVKLGITLSPELHQALKAYARAYEQAYGAPE--PLTELIPAMLAAFLETDRGFL-RARd 69  Sphin...
jgi:Astex_2490                   1 MVELKLAKLPDRTPVKLTIMLGAELHQCLRDYAELYAAAYGATE--QVVDLIPYMLEAFLQSDKGFQ-RGgk 69  Astic...
jgi:Astex_2674                   1 MADLKLPKLPDRTPVKLTIVLGSELNEALKAYADRYAEAYGTVE--PVVELIPYILEAFLASD-------RK 63  Astic...
jgi:Caul_2036                    1 ---MKLAKLPDRNPVRLTISVLPDLNARLAVYAEAYKATYGEAA--SVTDLIPAMLELFLDSDRTVA-TGRK 66  Caulo...
dbos:1099484000100_PB2503_03562  3 aTTLKIGPLPDTTPVKLTIAVDPDVNADLELYAQIYEETYKEKA--SVAALIPSMLEAFLASDSGFK-KARK 71  Parvu...
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap