Conserved Protein Domain Family
DUF2269

?
pfam10027: DUF2269 
Predicted integral membrane protein (DUF2269)
Members of this family of bacterial hypothetical integral membrane proteins have no known function.
Statistics
?
PSSM-Id: 401856
View PSSM: pfam10027
Aligned: 32 rows
Threshold Bit Score: 88.4916
Threshold Setting Gi: 500251300
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q3JDP2          4 TLLKFVHLLGAILIGAGLIGVWMSDLRSRQLRELNVFAEAVRNIAVFYDG--VVVPGALLLLISGSWMIVKFygGWDFvK 81  Nitrosococcus ...
Q87YW1          4 LYLKYLHVIAAIFLFGFGMGSYLYLIAASRSGNPVVIAHVARMVVRFDTW--ITTPAGFVQVITGYAMVRLS--GMAL-L 78  Pseudomonas sy...
Q9I6F9          5 lqIKILHGVATVLLFGGLLGLAFYAWRSWRTGDAARVARGFKRVRLIGWP--LLGLSLLALPVSGWWLVHLA--GWPL-G 79  Pseudomonas ae...
jgi:Pmen_4220   5 LLVRILHGAPGVLLLLGLIAHGVMLFKAQRKADAAVLARKLRVTLLFSFP--AFAVLALSLPVTGYWLVDTA--GWPL-G 79  Pseudomonas me...
WP_011911642    5 LTLRIVHGATAVLLLLGVIVHLLMLWKAARGGDQAVLQRKLQRTRRLSLP--LLAVIGLSLPVTGWWLTHLA--GWPL-G 79  Pseudomonas st...
Q4K471          5 TTLKTLHVLATVLLLGSALGLAIWVWRLRRQGDATVYSRVLHRPGLFGWL--LLALGMLTLPFSGWWLVHLV--GWPL-G 79  Pseudomonas pr...
Q88CN2          5 TTLKTLHIIATALLFLGALGLAIWTWRARRQGDAEAYAKLLRRPLVFVWL--VMGLCLVSMPFTGWWLVHLV--GWPL-G 79  Pseudomonas pu...
Q08UN1          5 VLLRLVHLVAVVVFLGDIAVTAVWRLLADRTREPRVIVYALRLVLFTDKY--LLMPSVLVLVVTGFLSAHLQ--GISLwS 80  Stigmatella au...
Q8EL83          5 ELLVFIHIFSAILGMGPGFVMTV------IVKNAGNMTELRHAFVIRNTLhrFSMVGGTILLLTGVWMGFLH--PYLF-T 75  Oceanobacillus...
Q2S703          5 PLVKLIHILSSTLLFGTGLGTAFYMWRADCSGDVRVIAVVARNVVLADWL--FTTPAVIIQPLTGFLMLHWL--NIPY-S 79  Hahella chejue...
Q3JDP2         82 ISWLLGMVVLFAFEFIEENTVTRlYFMRLRWVTRDALQRGAItSELEKVRGEGIPTFTHFLDLPILFLIVALGVIRP 158 Nitrosococcus oce...
Q87YW1         79 TDWIISSLIIFACVGALWLPVLI-LQKRLERLADHAVATGTL-IDDQFQSVYRLWFWLGVIGFSGMFLIVLMMVTKM 153 Pseudomonas syrin...
Q9I6F9         80 QSWLLFGACLYLLGCIFWLVLAG-RLARVQHQAGAAETAGAA-LGEQTLREIKVGLVMALLGAASFIAVAVLMVSKP 154 Pseudomonas aerug...
jgi:Pmen_4220  80 QTWLLLGSILYALMMLLGLLLA--GRLAAWRALGDAPAPMS---------LKRLCLIYAGLILLLLIAIMALMGAKP 145 Pseudomonas mendo...
WP_011911642   80 QLWLLASSVLFVVLVALVPLLA--GRLAAWQAPGNAT-------------AARNAGIYGVLVLLVLIAITALMGAKP 141 Pseudomonas stutzeri
Q4K471         80 QTWVLGSSVLYTLGALAWLWLM--VRLNRLRVAKVAS-------------GLAFTLVLAVFSAACFVTIAGLMGAKP 141 Pseudomonas prote...
Q88CN2         80 QTWVLASSVIYTFGAFAVWWLL--VRLNRLRKAE--------------VVGLRFTLALAVFSGVCFLSIAGLMGAKP 140 Pseudomonas putid...
Q08UN1         81 NPFYALGQILFMASGVLWNVVLRpVQSRQLGLAESLGASEA--LFADYLLLTKKWLRWGLLTMACAFGSMVLMVLAG 155 Stigmatella auran...
Q8EL83         76 QGWYVVSLCLFLIAVAFGPFVLSpRSKPIKELLKNSEEEA---IPEHYYSLSSKLFFFEHMINILFITIITLMILKP 149 Oceanobacillus ih...
Q2S703         80 TPWIWMSLALFILVGLCWLPVVW-LQIQVARGAETALREGTG-FNYPHRAYMRIWYALGWPAFFAVIGIFYLMVTKQ 154 Hahella chejuensi...
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap