Conserved Protein Domain Family
DUF2232

?
pfam09991: DUF2232 
Predicted membrane protein (DUF2232)
This family of bacterial proteins are multi-pass membrane proteins with up to 10 (2 x 4/5) transmembrane regions. The exact function of this potential pore molecule is not known, but in many instances it is associated with ABC-transporter-like domains, implying that it is part of a secretion system that uses energy.
Statistics
?
PSSM-Id: 370773
View PSSM: pfam09991
Aligned: 36 rows
Threshold Bit Score: 132.344
Threshold Setting Gi: 81364820
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q97CX7        17 VILFVLVF--LGVYgYGIIQFMM-FLTPLPFAIVYLKYGFKHSLLEVVIAA-VLSCIFIDPKIAALVMVMFLIPSVVFII 92  Clostridium ace...
WP_015924046  12 ALFVILILtfINVY-IPPLSIFTvFLWPLPVITVTVRNGMDRALKLVLVAAlVNGLVFQNALVALYTIIGFGLIGFAIGG 90  Halothermothrix...
Q5WAH6         8 VIYIALFM--IFAFnIPLLNMVAlVAMPLPIVYFTAIFGPRPGMVLTAAVGlLGTIATLNPLAA----FAFAVIGYVLGY 81  Bacillus clausi...
Q9K5Q6        15 SLFAVLFV--ITFF-VPFIAFITmWFLPIPFLLYTLRHGLKPAVIVLLVAS-VVVMLILG-PLLLLLALLFGTSGVVMGE 89  Bacillus halodu...
Q5KU72        15 ALFAVLFL--LALY-APVIGIVAaLFLALPFMVFTMRHGWIPAMLLLAAAL-VISGLIGS-LLSLPMALMFGTVGMAVGA 89  Geobacillus kau...
WP_022544626  15 AVFAVLML--LTLY-VPVLGVVTnLFLAAPFILFAATNDRKSSLVFLTGGI-LISLIVGT-ILAIPLALLYGITGTVIGD 89  Bacillus
ABV64351      21 SIFSVMTL--FYLY-VPLLSIIFfLAAPIPIILYTIRHGLKKGIAAGAIGI-VISFLIGS-INGLMTAPVLIAVGLGMGV 95  Bacillus pumilu...
Q65CQ1        15 SIFAVLLM--ISLY-IPFIGTILlLTLPLPAMVQTIRHGLKPGISVGLVSL-PVSLIAGS-LGGLMFAIPVSAAGVIMGF 89  Bacillus lichen...
P37485        15 SLFAIITL--LVVY-VPVIGTILlFALPLPMILYTIRHGLKLGIWMGAVSL-PVVFIVGS-FNGLIVAFMSACAGIAMGH 89  Bacillus subtil...
Q8EKW9        15 FIFTIILA--SFLF-LPIIAI---FVLPIPFVLFTRKYGMKSGFVMLAIAL-LISLLIMT-IIAIPLVVMMGLGGIMIGS 86  Oceanobacillus ...
Q97CX7        93 STKKGLSFSKTFIIMSIAYIAATVFEYTAILKVSNnitfINIVDDMVNSAKSSINDVGKMYLEA-GMnkqqvdDALDILR 171 Clostridium ace...
WP_015924046  91 ALAEGFTPFKTLIISIMAVLFSILTNYYALHFLIG----FD--------FNTLLQEMAANFTQIgGM-------LGYGLD 151 Halothermothrix...
Q5WAH6        82 AQHKRRKGAELLLATIVASFVFLSTAYILLTAVTD----LS----VLQFVRESLQETQQLLSEL-GM------ESYDKAF 146 Bacillus clausi...
Q9K5Q6        90 LYRREKSPFAVLLGGSLSNIAWVLLLFISSIVIMD----VNPLVAAQETMRQSMQTAEQLIIGL-GQe----pSEALKQM 160 Bacillus halodu...
Q5KU72        90 MLSKQKNRYLVLLVGALVFLANIVLDYIISIQFLH----VDMIQDTLALVRESFDTAMNLMKGM-GQap---pLEMQRQF 161 Geobacillus kau...
WP_022544626  90 FIREKKSRFSTYMASSLAFLILLVAQYGIAVQFFE----LNVIKESFDILKQSVDKIVSLMENL-GQpl---dEKMKDQL 161 Bacillus
ABV64351      96 FYSRRQPGNAI-IAGGLIYLFSFLISFIVSVQLFQ----IDIMNIAKESIEQMMPMVESTLKQS-GAsek-eiAKQLKQF 168 Bacillus pumilu...
Q65CQ1        90 YYRRKEPAQAI-AAAAVTYMVSFVLLLIISVQFLG----LNLIETANQAYNETFKTFESSIKQF-Gndk--evAKQIELL 161 Bacillus lichen...
P37485        90 FFKRKEPGHAI-ISGALIYMLSIVFYFVISIQFLG----INIIDEAMTQYRQSLDIVETVAKQS-Gnag--qfEKQLKLM 161 Bacillus subtil...
Q8EKW9        87 AMYKGVTPYDTLARGIFGFIMGILFTFGFTQVFLD----VNLVNQFQTVVEDSVETSTAFIEEM-GLae--qsEQILEVA 159 Oceanobacillus ...
Q97CX7       172 QSFtRQNILNVVPGLLTILSTISAYFTCFVGERIF--NRLKIK-VNYQLKIYNIYINNLVLAFSIILGCIGLVLKTRNII 248 Clostridium ace...
WP_015924046 152 VEEwVAFVRSVIPSALVIGSIIFGSIVYYLSVNFLniRRDEDNrFEVYKPFRYWRFPAWLITSGLVISLFFLD------- 224 Halothermothrix...
Q5WAH6       147 IEEyVQLIESLMTFLLLLMAAAYAFMVYGAATMLF--KRVDLP-YHKLPKFREWAFPRFFLWFYFSLLLLSFLPFEPGSY 223 Bacillus clausi...
Q9K5Q6       161 EES-INQLFYLGPAMVVICGTLLAAVTQLVAAPIL--KRLRHE-VKPLPPFRTWSFPRSFLFYYLAVVVLF-MIGFEEGS 235 Bacillus halodu...
Q5KU72       162 EQG-LKLIGYMVPTLFVIASFALAYATIIVSLPVM--KRLKLP-VGSWPPFRELMWPKTVLWLYVFVLLLSLFPFKE-GS 236 Geobacillus kau...
WP_022544626 162 YSG-IGLTETLIPSLLIMASFINVLILQAVSLPIV--NRFGVN-MEKWGQFRNLSLPKSVLWYYLITIIAALLLKPEEGT 237 Bacillus
ABV64351     169 KEL-QDTALNALPVALLITATLMAFVNHWFVRPLI--KRFVSD-MPVLKKFKDLRLPKSMVWYYLLTLLLM-LIQTEKGS 243 Bacillus pumilu...
Q65CQ1       162 NEQ-FKQAQYLYPTAIVIFSGITAFLNHLLAKPVL--RRIIQ--IPSLKPFRDMRLPQSIIWIYLLTILLS-LAPVEEGS 235 Bacillus lichen...
P37485       162 EEQ-LGIVQYLFPTAIVMVGVIFSFLSYLIAKPLL--RRFSPD-IPNLKPFRELKFPQSVVVLYLIIVMLS-FLPLEKGQ 236 Bacillus subtil...
Q8EKW9       160 ETQ-IQMMTELLPSFLVAAAAILALVVQWLSYKII--NRTDKQ-KLRFPPIRDIRFPSSIIWIYFLAFIVSLFNQ-EPGT 234 Oceanobacillus ...
Q97CX7       249 LGDYIYYTVSMTMGLYLIVTGLSLIVYYLKFKqkLSNWIIA---LILVVGILLVqLLYYVYMALAFVDS 314 Clostridium acetobutylicum
WP_015924046 225 --SVFFLNLQIVFLFLSFIQGLSLAIYYLVESg-NKAFLWA---LILFFGFLIH-IMVLPVAILGLVDM 286 Halothermothrix orenii
Q5WAH6       224 M-AAVTQTGINLVSVLLIIQGVSLLFVYLQAKr-LAKGVSVfiiIMVVISLLLVpFLLWAMKMIGVLDM 290 Bacillus clausii KSM-K16
Q9K5Q6       236 MPYIAVWNLLPVLEIIMAIQGFAVIFAYFHTKg-VAKAVPV---IIMILCIIVT-PLLYLVRIIGIIDL 299 Bacillus halodurans
Q5KU72       237 FAYIAVLNLSYVLQLAMIVQGFSFLYYAAYKKg-VGKGVVA---AGTVVCLFLP-FLLYLVAIFGIIDL 300 Geobacillus kaustophilus
WP_022544626 238 VLFDAFINLSFILQLLMIVQGLSLVFYFCHIKg-YPRAVPV---IAAVLSFILP-FLLYIIRILGIIDL 301 Bacillus
ABV64351     244 FLWLVQSSAFKILFILVLIQGFSFIFYYCHEKg-ISKAVPI---FAIVLGVLYP-PVGVVVRIIGIADI 307 Bacillus pumilus SAFR-032
Q65CQ1       236 VYYSVLLNASLIMGFVLVIQGFSFVFYFCHAKk-LPTVLPV---LFLIIGLFSP--LLYLVRILGIIDI 298 Bacillus licheniformis DSM...
P37485       237 MLYSIALNGEFILGFLIFIQGLSFIFFYCHKKq-YPKAAAV---IAVILGFVHP-VFMAAIRILGVLDM 300 Bacillus subtilis subsp. s...
Q8EKW9       235 TLYVGLQNLFFIVGMLLAIQGVSFIFYYAHAKk-MSKAIPV---IIVILTLVFPqFLLYFIRILGIIDV 299 Oceanobacillus iheyensis
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap