Conserved Protein Domain Family
DUF2227

?
pfam09988: DUF2227 
Uncharacterized metal-binding protein (DUF2227)
Members of this family of hypothetical bacterial proteins possess metal binding properties; however, their exact function has not, as yet, been determined.
Statistics
?
PSSM-Id: 401822
View PSSM: pfam09988
Aligned: 59 rows
Threshold Bit Score: 105.439
Threshold Setting Gi: 297163481
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_015171703          2 PSGGTHDRITLWSLPLVTGATIA-----------CTRDGDLALLLAGGYLFGGLMFGPDLDIR-----SRQFLRWGLLRW 65  Geitleri...
jgi:Deipe_1758        2 PSGQSHTFINLAAYAVLGSVALYvhr-----qgiFFIGQEDALFFTLGFLVGTVFLSPDLDLAeghvnSK--RAWGFLGA 74  Deinococ...
WP_013558007          2 PSGNVHNLINTAAYAALFAATALaqh-----agyVHVTPVQGLAFTAGYAAGTFLLSPDLDLAegrvnSK--RYWGILGF 74  Deinococ...
jgi:Deipr_1669       12 PSGRVHNYINMAVYAALGAGAVWagr-----eglVTLTQTQTLHFSLGFLAGTFLLSPDLDLSeqgvnSK--RNWGFLGP 84  Deinococ...
Q9RT76                5 PSGRVHNLINLGTFAVLGTAALYvqraqlwpdptFTLTPTMALNFTWAFMAGTFLLSPDLDLSegrvdSK--RRWGPLGF 82  Deinococ...
WP_014684879          2 PSGRVHNLINLAAYAVLAAGALAasr-----qdlIGVTPAQAINFTLGFLAGTFLLSPDLDLSegrvdSK--RRWGVLGF 74  Deinococ...
ACO46101              5 PSGRVHNLINIAAYSVLAGAVLVasr-----qdiLSITPSQALYFTLAFAVGTFLLSPDLDLAegkvdSK--RHWGVLGV 77  Deinococ...
jgi:Mesil_3088        2 PAGRIHEAINVGALGLLSASYVYeq-------nhLGLSEPAAFGFAVAYLIGTFLVTPDLDLAeqrvrAK--GNWGVLGW 72  Meiother...
WP_013012759          2 PSGRVHEAINLSVLGLATAAYWVyr-------qdLEVPQPVAVAFMGSYLLGTFLITPDLDLAeqqvrAK--GRWGWMGW 72  Meiother...
jcvi:cds.PERMA_0099   2 ASGRTHEIINLLFLPGAV----------------YYLNPVSFEGFISGYIIGTFFLSPDNDIYh----SKPNRRWGFLRF 61  Persepho...
WP_015171703         66 LWLPYQRGLRHRSlLSHGPVLGTLGRLAYLGLWlg-aVWSLGVFLWAIAQQGVGasaswravaEPAWRstlpwlwSLLQR 144 Geitleri...
jgi:Deipe_1758       75 LWVPYGLLFSHRG-WSHSWLIGPLTRLIYLAVMvavvTGLLHFL---------------------LPsvd--wpvTSLAF 130 Deinococ...
WP_013558007         75 LWVPYGMLFSHRG-LSHTWLIGPLTRLAYLGVIvalvVGLVAFL---------------------VPdlr--lpgLPSSL 130 Deinococ...
jgi:Deipr_1669       85 LWVPYGMVFSHRG-LSHTWVIGPLTRLAYLAILvflaVGALRTF---------------------WPgvn--lpaLPDPI 140 Deinococ...
Q9RT76               83 LWVPYGRMFSHRG-LSHTWIVGPLTRLLYLGLIagavWTVLKFA---------------------LPQlglgwprLPQPL 140 Deinococ...
WP_014684879         75 LWVPYGRMFSHRG-LSHTWLLGPLTRLAYVAVLlglvAGIVRVA---------------------FPawq--wpaLPEPV 130 Deinococ...
ACO46101             78 LWVPYGMLFSHRG-LSHTWLVGPLTRLAYLAALlaliVGLLRYV---------------------APsvt--vpaIPQPI 133 Deinococ...
jgi:Mesil_3088       73 LWVPYGLIFSHRG-WSHTWIVGPLTRLVYMVLMgallWFGGEAL-------------------LHYLGvqldlrgQVRLP 132 Meiother...
WP_013012759         73 LWVPYGWMFTHRG-LSHTWVVGPLTRILYLGAMgvlvYWFFTTL-------------------SSYLGlnihlqpHFKAP 132 Meiother...
jcvi:cds.PERMA_0099  62 VWYPYTKIFSHRG-ISHIPVIGTATKIVYLSLVslilIYIFIFSLKYAFPDLDIqildr-----------frdvdIYSFL 129 Persepho...
WP_015171703        145 YPQEAIALGLGLELGAMSHSLSDWLGSSYKRWR 177 Geitlerinema sp. PCC 7407
jgi:Deipe_1758      131 SWSLALPLLVGYYLSQWLHLIADGVRPDHKMRW 163 Deinococcus peraridilitoris DSM 19664
WP_013558007        131 DWKGLLPLLAGYYLSQWMHLIADGVRPDHDLRH 163 Deinococcus maricopensis
jgi:Deipr_1669      141 EWKVLLPVTLGYFLSQWLHLIADGIRPDHGLRR 173 Deinococcus proteolyticus MRP
Q9RT76              141 PYKVLLPVAAGYYLSQWLHLLADGVYPDHDVRH 173 Deinococcus radiodurans
WP_014684879        131 GLKFAVPLLLGYYLSQWLHLIADGVHPDHGVRH 163 Deinococcus gobiensis
ACO46101            134 SVKVVAPLIAGYYLSQWLHLIADGVRPDHGMRR 166 Deinococcus deserti VCD115
jgi:Mesil_3088      133 PEQVLYSGVAGYFASQWMHLLADGIWPDAgfrr 165 Meiothermus silvanus DSM 9946
WP_013012759        133 PQEVIWALVLGYYASQWLHLIADGIWPDSGRIF 165 Meiothermus ruber
jcvi:cds.PERMA_0099 130 SGSFVFSFIFGIFLAEMVHIFTDFVYSTLKRFk 162 Persephonella marina EX-H1
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap