Conserved Protein Domain Family
DUF2209

?
pfam09974: DUF2209 
Uncharacterized protein conserved in archaea (DUF2209)
This domain, found in various hypothetical archaeal proteins, has no known function.
Statistics
?
PSSM-Id: 401811
View PSSM: pfam09974
Aligned: 11 rows
Threshold Bit Score: 149.059
Threshold Setting Gi: 2495794
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q8TY51             4 VGVDVSGRHAEEDGhYNRITACVSAEVDGFNVFTVRDVNVFVVCTREPPNLRTLTEEVSRALNGLdkddEY-MVVAEPGE 82  Methanopyru...
jgi:Mmah_1419      5 IAVDISGRHRHNSR-YLMVCAAVSLSVSGGHVKQIHGVNIKPFVSDNPPEVVDVVQMIERTVEGM----EGvTIVAEEGD 79  Methanohalo...
jgi:Metho_0747     5 IAVDISGRH-VEDGeYFMVCVAVSFSVFPDHIDKTHQINIRHFTSRNAPEINDVATMVEKTVEGLn--pQA-TIVMEAGD 80  Methanometh...
sklmb:Mhar_0964    4 VAVDISGRHAVA-GrYIMVSASVAARISPEGVERTRRMR-LVPRVAESVDMEVVIGLMEESVRGL----SG-VVLAERGD 76  Methanosaet...
BAI62730           4 VAVDISGRHKLADGrYHLVCVAVSAVLSPFDVEKIEDMR-IYHEEADDVSVETVADLIKRAATRY----RG-AVVTEPGE 77  Methanocell...
KHU:HacjB3_09335   2 VGIDISGRHEER-GeYLMVGAAVAASVGSNRIREVTGIG--LATSRLEPTLEATLSIADEAIGALpdlpEG-PVVAERGE 77  Halalkalico...
Q57560             1 MAIDISGRHHEN-DiFFRVYAGVLVEIKADRIVHVEKID-VMVKEEETQKLRDIVKEVKELIDKVgd-eFD-YILCERGE 76  Methanocald...
Q12TG5             5 IAVDISGRHKIKDG-YYMVCAAVALEVSASHIESISQVAIKPFLSHDPLAVLDIVRIIEVTVSEIa--fPG-TIVVEKGD 80  Methanococc...
jgi:Mzhil_0465     5 VAVDISGRHRTSRGhYYIVCAAVSLSVSPDHIEKIHQVNTKAFRMYRPLKVLDVVQIIEKTVSNIk--rEG-VIVTEKGD 81  Methanosals...
WP_013194031       5 IAVDISGRHKIKNG-YYMVCAAVSVVSSADHVEKVNQVKIKPFWMDSAPQVTDVVRIIEDTVKEIk--yDG-TIVAEKGD 80  Methanohalo...
Q8TK02             5 IAVDISGRHRIKDG-YYMVCAAVALTVSADHIEKVKQVKILPFWLKRAPGLLDVVQLIEDTANQLs--fEG-TIVAEKGD 80  Methanosarc...
Q8TY51            83 FFGEPEWRVSALLGAPFKYAETVAEREVVEMAHKLAYGVYRGVK 126 Methanopyrus kandleri
jgi:Mmah_1419     80 FFNQPEWLSNSMFTASFKYPESLSERMGIEIAHHISLSSRNLLL 123 Methanohalophilus mahii DSM 5219
jgi:Metho_0747    81 MFNRPQWLVTGMFSRDFKYQESLSERRAIEIAHHISMSARRLLK 124 Methanomethylovorans hollandica DSM 15978
sklmb:Mhar_0964   77 LYNLERWRVESILGREFKYPESRGERRAVELAHHASFAGRRLAl 120 Methanosaeta harundinacea 6Ac
BAI62730          78 FYNYPEWRVEAILGRKFKYAESVGERKAIEVAHHVSLAVHRMLH 121 Methanocella paludicola SANAE
KHU:HacjB3_09335  78 FYEEPERAVGASFAPEFKYVESIGERRTIEIAHHAAYATRALIl 121 Halalkalicoccus jeotgali B3
Q57560            77 FFNISKDIISAILKKEVIFPKTRGELEAINIAHHVSYSVRKLLI 120 Methanocaldococcus jannaschii DSM 2661
Q12TG5            81 LYNQPEWLSKNMFSRDIKYQESLSEMLAIEFAHYVSLSSRKLLM 124 Methanococcoides burtonii DSM 6242
jgi:Mzhil_0465    82 MYNKPLNFVSSRFKGEFKYQESISERLAVQLAHHISLSSRKLLV 125 Methanosalsum zhilinae DSM 4017
WP_013194031      81 MYNKPEWVATSMFSKNFKYQESLSERLAIEMAHHISLSARNLLI 124 Methanohalobium evestigatum
Q8TK02            81 MYNQPLWVPESMFSGAFKYQESLAERRAIELAHHISLSARNLLI 124 Methanosarcina acetivorans
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap