Conserved Protein Domain Family
DUF2139

?
pfam09910: DUF2139 
Uncharacterized protein conserved in archaea (DUF2139)
This domain, found in various hypothetical archaeal proteins, has no known function.
Statistics
?
PSSM-Id: 401762
View PSSM: pfam09910
Aligned: 10 rows
Threshold Bit Score: 567.753
Threshold Setting Gi: 74578460
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
CBRAS:ASAC_0523  28 LYYTLAFDAIANFVTDSG--VE-RYRFEQVGPLPTSGGDTYNAVDAVDDNIYFGGWVHAPAVYEGsEASLRGTISFVNKY 104 Acidilobus s...
imbp:Hbut_0624   37 LYYTLAFEAIAFFHHDDC--ETrIYRFEHIGKPPRSGGDTYNASVAVDGTIYFGGWVHAPTDVLH-TADGRSVISFTNKY 113 Hyperthermus...
Q9YEL8           28 LFYTLAFEARSTLLRGDC--SWsSYDYSLVGPPPRSGGDTYNAVEAVDGKIYFGGWAHAPAVLERkGKGRLAEVVFTNKY 105 Aeropyrum pe...
jgi:Tagg_0104    25 VYYTLAMEGEAHFHHEDS--ES-IYRFELLGNGPASGGDTYNAVDYVDDKIYFGGWVHKPAIYKG-RVNGGGEIDFRNKY 100 Thermosphaer...
WP_014737429     28 LYYTISMEGEAHFQHDNE--ET-VYRFELLGPGPSSGGDTYNAVETVDEYIYFGGWVHNPAVYKL-REGFAGEIDFRYKY 103 Thermogladiu...
jgi:Aboo_0526    36 LYYTVAFDAEAHFIKDYD--EQ-LYNFRMLGKAPASGGDTYNAVEAVDDFLYFGGWVHAPAIYKG------GKISFKNKY 106 Aciduliprofu...
Q8U4F6           28 LYFTLAFEGEAHFITEDS--HK-IYEFELVGPRPTSGGDTYNAVEVVDEYIYFGGWVHAPAKYRG-KGEGKATIDFSNKY 103 Pyrococcus f...
Q5JHH5           31 LYFTVAFEAEAHFIDVKSgeEK-TYDFTLVGDAPTSGGDTYNAVETVDEFIYFGGWVHAPAVYRE-----DRRILFNNKY 104 Thermococcus...
jgi:Smar_1116    35 LYYMLAFEAQGYFIDRGG--IRkIYEFEKLGFKPVSGGDTYNAVYAIDDSIYFGGWVHAPAIYRG-RTSKGATIDFRNKY 111 Staphylother...
jgi:Igag_0345    35 LYFTLAFEAIAHFVRDDG--IR-IYRYEYVGPLPTSGGDTYNAVDTVDDEIFFGGWVHAPAIYSGrRDGRRATISFTNKY 111 Ignisphaera ...
CBRAS:ASAC_0523 105 SHVHFYDVEDRRVSLLWKEGAARKDEWAGEVSEIIYNPVQDELLVARGDGTINLGVYGIDRRTGEPRKLSERPALKGALV 184 Acidilobus s...
imbp:Hbut_0624  114 SHVHAYDTGERSVKLLWLEGGGDKRQWAGEVTDLLYNPSTDTLLAARGDGHFNLGVYEIDRRRGAARRASGKRVLRGTIY 193 Hyperthermus...
Q9YEL8          106 SILHEMDVDTGEVRLLWKEGARDRRLWACEVSEVLYNPLRDTLLLARGDGHINCGIFEAGRRGG-VRKLSSTPVLKGEVF 184 Aeropyrum pe...
jgi:Tagg_0104   101 SHIHEYDIAERRVRLVWSDSIHHEYEWVGEVSQIVYDPLSDSLLVARADGMRNLGVYKIDRNTGRAEQVSSVPALKGALY 180 Thermosphaer...
WP_014737429    104 SHVHEYNINEKTVKLVWSETARSEREWAGEVSEIVYDWLNDKLLLARADGHFNLGIFELDRSSSELKRLSDIPGLKGSLF 183 Thermogladiu...
jgi:Aboo_0526   107 SHVHEYNIEDDSLRLLWKDSIHHSTKWAGEVSDIIYDPYEDRLLIARQDGDEHLGVYAIDRDTGDEKKLTDSPSLKGDIL 186 Aciduliprofu...
Q8U4F6          104 SHVHEYDTENQEVRLVWKESIHHPSEWAGEVSDIIYNPYTDELLLAREDGHTNLGVYSLSRN-GRIRLLNDKPSAKGCQM 182 Pyrococcus f...
Q5JHH5          105 SHVHVYDTAEGSVKLLWKESIHHETDWAGEISDIIYDPYGDRLLLAREDGHANLGVYSLDRKRGKAEPLITEPSPKGTRV 184 Thermococcus...
jgi:Smar_1116   112 SHVHKYDISNNEVSLIWKESMHDPEKWVGEISEIIYDPYEQKLLLARADGHTNLGVYELDPSSGKTRKILDEPALKGAIN 191 Staphylother...
jgi:Igag_0345   112 SHVHKYNISEDSITLLWKEGLHHETDWVGEVSEIVYDPINDRLLLARADGMKNLGVYQIDRKGGNYKQLSSIPAMKGSLF 191 Ignisphaera ...
CBRAS:ASAC_0523 185 YEYACFDILERQikdihgvlftKAVTGIQCVNLTN-GKVTYTSLGDISRRSVDGAPVSWPQT-GPAASAYGRFFLFVKGG 262 Acidilobus s...
imbp:Hbut_0624  194 MDYACFTLHHGW----------GGRPGLHCINLDNySQTVTVELDPVETYSVDGGGLWGYRS-GDIEAAYTKLYAAVKGG 262 Hyperthermus...
Q9YEL8          185 MDMACFSIHHGW----------GGNPGLECVDLES-GETVYTGEAVPEEAGLDGGGLDHYRE-GAVFQLHTRVYVAHKGG 252 Aeropyrum pe...
jgi:Tagg_0104   181 QEYACFDLQPDWk---------RGVDGVQCFDLVE-KKLVKNYIEDWSKISIDGYPVERRGS-GYATTGYTRYWHFFRGG 249 Thermosphaer...
WP_014737429    184 LEFACFDMRPDWr---------RGVDGVQCYDPHE-KRMLYYSVRDWAAASVDGEGVENRGS-GYAVSAYARYWHFFRGG 252 Thermogladiu...
jgi:Aboo_0526   187 HDSAFFTSGDSFs---------KGIQKVMCFDLIE-KK--WTEFPVNNIISMDGEDILVNSV-GDVASIYNRFFVFTRGG 253 Aciduliprofu...
Q8U4F6          183 HDLAFFGIGKNYr---------KGLEEIHALDMIT-ER--WEVFPLG--ESLDGGKYIQPHLgGNGVSVNNRVFAFVRGG 248 Pyrococcus f...
Q5JHH5          185 HDVAFFGVGNNFt---------GGVREFRALDLIS-GK--WEAFKPG--GSVDGKPYERPEL-GAMASAYNRAFAFVRGG 249 Thermococcus...
jgi:Smar_1116   192 LDYACFSIHyf----------pKSFNGIECVDLIE-RKTLIDKFDPG-KYTIDDGDVLYPLV-GPVSSLYGRVFAFMKGG 258 Staphylother...
jgi:Igag_0345   192 YDHVCFDMFPDWi---------NGVNGIQCIDLIE-NRVRYIEFGDVSKMSVDGGGVEWRLT-GASISAYGRFFLFVRGG 260 Ignisphaera ...
CBRAS:ASAC_0523 263 AFVGNPIDEgtePVRFVRLFDFGESGYFSRRTVAKPIGGGVMVAFNAYSESLVRPTNQFEEMVARATNTIVGPSVLLYIT 342 Acidilobus s...
imbp:Hbut_0624  263 IIVFDPFGN---EHVFVRMMDFHYNTYGPLRSNILPLAGGLLVAFSAQSHATVRGTDELPEVQQKASQRPVAPSILVYIS 339 Hyperthermus...
Q9YEL8          253 FTVFDPEGGg--EPRFYRVLDFGDNPYSPTRTNALYLGGGVLIPFNTPTAATVRGTDELPNNVQRSSRRSPAPTLLVYVT 330 Aeropyrum pe...
jgi:Tagg_0104   250 LIVGNPAEPdieELTFVRMFDFPGTPYAPHRSNALPIGGGILAVFNSYSHGYIH-VAPEGRARARLFNTVVGPTTLVYIT 328 Thermosphaer...
WP_014737429    253 LLVGNPVEPdveEPLFVRLFDFPGTQYSPSRSNALVIGGGVLAAFNAYSHGVLH-VAEPKKSLVKTLNYTVGPSVLVYIT 331 Thermogladiu...
jgi:Aboo_0526   254 ILIGNPLSGe--NFRAARLFDFF-TFQSPMRSNTLYINGGVLIAYNAHHDALYSVKTLEDKVKYTLTNAIVAPTLLIYIA 330 Aciduliprofu...
Q8U4F6          249 VFVGNPHNDe--QFAFVRLFDFY-TFYAPFRVNALPIGGGILVGFNAHHDAYYRPRTQEEMIYHRFTNTIPGPSVLVYFA 325 Pyrococcus f...
Q5JHH5          250 IFAGNPYMGe--VFTFYRLLDFP-TFYAPFRVNAINVGGGILTAFNSHHDASYRKDSSDAGIGWDFTNTLVGPSVLVYIA 326 Thermococcus...
jgi:Smar_1116   259 VLVYNPVLG---EKYFVRLLDIPYSQLGPARANAKIFGGGVIVPYNMFVHSVINPTNEFEEKAKKATNTIISPTLLLYIA 335 Staphylother...
jgi:Igag_0345   261 IFIGNPIDEgiePIRFVRLFDFGLSGYNARRTMAKPFGGGILIPYNAYTEAIIYPTNEVEEKLKLATNTIVGPSILLYIS 340 Ignisphaera ...
CBRAS:ASAC_0523 343 PPVARIVGAYGARITSFESVGDRLVIGANTMSNTSRY 379 Acidilobus saccharovorans 345-15
imbp:Hbut_0624  340 PPTARIVAALGVRITSMTLMGSKVLIAGNTVPNLERY 376 Hyperthermus butylicus DSM 5456
Q9YEL8          331 PTDMRIVGSLGARVTSMEALGDKVLLAWSTQPNFERY 367 Aeropyrum pernix
jgi:Tagg_0104   329 PPVARIVATLGARVTSMTKKGGSILIGVSNTPNLGGk 365 Thermosphaera aggregans DSM 11486
WP_014737429    332 PPVARIVLATGARITSMTKRGNDVLLGTNNSPNLGGr 368 Thermogladius calderae
jgi:Aboo_0526   331 PPMAKIVGAFGARITSMEIVGDKIVIGTSTSPNLGAG 367 Aciduliprofundum boonei T469
Q8U4F6          326 PPMVKIVGVFGARITSIEKVDGKILVATNTTPNVGAL 362 Pyrococcus furiosus
Q5JHH5          327 PPMVKIVGAFGARVTSIEKMDGKLLVATNTTPNTGAT 363 Thermococcus kodakarensis KOD1
jgi:Smar_1116   336 PPLVKIIGAFGARITSVEVIGDQILLAHNTMANTYRY 372 Staphylothermus marinus F1
jgi:Igag_0345   341 PPIAKIIGVFGARITGIEVIDNKLLLAVNTMANTGRY 377 Ignisphaera aggregans DSM 17230
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap