Conserved Protein Domain Family
DUF2107

?
pfam09880: DUF2107 
Predicted membrane protein (DUF2107)
This domain, found in various hypothetical archaeal proteins, has no known function.
Statistics
?
PSSM-Id: 401739
View PSSM: pfam09880
Aligned: 12 rows
Threshold Bit Score: 77.7151
Threshold Setting Gi: 490138131
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q6LXA0            8 LYVGYFLLIIGTVGAVIGPLTKDPFKRFLNIEVPAIGVCLIFLAYNQTLALMTFLGVNAILTLVLVRTIIKNE 80  Methanococcus marip...
jgi:Maeo_0361    10 MYCGYIMLIGGTMGAIFGPQANDPFKKLLNMEVPAMGVALILLSYNHTLALMTFLTVNTILIIVFVRAIIKNE 82  Methanococcus aeoli...
WP_013180974      8 MYTGYILLIIGTIGAVLGPMSKDPIKKLLNVEVPSVGLSLILLAYNHTLALMTFLAVNAAIGLVLIRAVIKTV 80  Methanococcus voltae
WP_004038488      5 lILGLLVLIIGALAAAF-PRPKTYLSRIISLEIPAWGLLLIMLAYNETLALLTFIAVTAISTFVMVRVVERRm 76  Methanofollis limin...
ABN06738          7 FIVGCILLLAGVIFTAY-PREKTYLTRLINMEVAEFGLVFIMLSFNETLALVTFVAVNVVTTLIFVRVIEKKE 78  Methanocorpusculum ...
Q2FMA5            5 FFAGLILLIIGTWITAF-PRDREYLTRLINLEIPAFGLLLVALSFDETLALLTFIAVSTLTTFVLVLLIERRa 76  Methanospirillum hu...
WP_004076155      6 FALGCIILVIGVIAAAD-PKPKTPLIRLINVEIPAWGLLLIMLSFNETLALMTFIAVTAIATFILVRVLERSd 77  Methanoplanus limicola
Q8TY33            8 LYTGAFMIILGTLGAAIGPARSDPVVKSLNLELATVGVCLVFLAFNHLLALITFIAVGAFTTPILMRAILRVE 80  Methanopyrus kandleri
O26488           11 FYAGAALVVIGSIATVAGPGVRDPIVRILNTEIPAVGVSLIFLTYNHTLALLTFIAATTIMTLVLLRAVIRLE 83  Methanothermobacter...
WP_023992249      8 FYTGVALAILGSIATAIGPGVKDPIVRTLNAEIAAVGVSMIFLTYNHSIALLTYIAATAIITMILLRAIVRLE 80  Methanobacterium sp...
agres:mru_1408    8 vYLGLALAIFGSLATVWGPGVKDPVIRTINTEVASVGVSLILLCYNSTLALLTLIATTIIVTLILFRAISRLE 80  Methanobrevibacter ...
NZAGRC:Abm4_0950  8 FYAGIILAVVGTLGACWGPGVKDPVVRTMNTEVASVGVSLILLCYNHTLALLTMIATSVICTLILFRAISRLE 80  Methanobrevibacter ...
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap